1MZJ


Conserved Protein Domain Family
ACP_syn_III_C

?
pfam08541: ACP_syn_III_C (this model, PSSM-Id:117118 is obsolete and has been replaced by 337099)
Click on image for an interactive view with Cn3D
3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal
This domain is found on 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III EC:2.3.1.41, the enzyme responsible for initiating the chain of reactions of the fatty acid synthase in plants and bacteria.
Statistics
?
PSSM-Id: 117118
View PSSM: pfam08541
Aligned: 187 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Dec-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1MZJ_B 241 LEVAGLTVGDLVAFVPHQANLRIIDV-LVDRLGVPEHvVVSRDA-EDTGNTSSASVALALDRLVRSGAVPGGGPALMIGF 318 Streptomyces sp. R1128
Q8KND4 245 LAEAGIGTGDLAKVSFMNYSREVVEQrCMAPLGLGME-KSTWDFgRMIGHCGASDHLLALHHSLRAGEVAAGDHVLWLAM 323 Micromonospora echino...
Q72KF2 241 LEEAGYTEADLDYLALLHMKRSAHRA-VLAGLGLSEE-RS-IYL-ERFGHLGQLDPLLSLRLAREKGLLKEGSLVALAAA 316 Thermus thermophilus ...
Q67RA0 248 CAQGGYRTQDIDYLAILHMKRSAHQA-LIEQLGIPVD-RA-IYL-EEYGHIGQIDQILSIHLALERGLIRDGDLVVGVSA 323 Symbiobacterium therm...
Q8RC85 250 LRKSGYTPSDIGYLAILHMKRSAHEF-ILNELGLSPD-KS-IYL-ENYGHMGQIDQILSTHLALEEGKIKDGDVVVWVSA 325 Caldanaerobacter subt...
Q63CM4 243 LRKSGYTPKDIKVLLPLHTKRSMLIE-LIQGLGLT-E-EQVVYL-DHYGHMSALDPCIGLHFANEQGKLQAGDIAVVVSA 318 Bacillus cereus E33L
Q67MB7 254 AEQSGFRPEEIRFVGMLHTKRSLFDQ-VMAALGIPPE-RQ-VYL-DEYGHMSAIDPLVALYEAERRALLAPGDLAVLLSA 329 Symbiobacterium therm...
Q847B9 248 LQKSGYLITEVDFLLTNQVKKSLSKA-ILASLNLKDE-QTFISL-PKYGHLGAVDTIFGLAKTLESKKIKPGNLVVLASS 324 Nodularia spumigena
Q7NZW4 228 LDALGRSLAEVRYLLINHGDEDMHRS-LLARLDLSEE-RTVFNY-HRLGHMGSADTLIALEQLEREQQLQAGDLILLASS 304 Chromobacterium viola...
Q6AQA3 255 FAAPGWRNEEVDAYCCHQVGVAHFRM-LFDRLGLSEE-KNFQTL-PFLGNVGTVSAPITLAMAMEEGAFKPGERAVMLGI 331 Desulfotalea psychrop...
1MZJ_B 319 GAGLSYAGQALLL 331 Streptomyces sp. R1128
Q8KND4 324 GPGVEFTAAVLRV 336 Micromonospora echinospora
Q72KF2 317 GVGYFYGAAVLRL 329 Thermus thermophilus HB27
Q67RA0 324 GVGYAWGATAIEW 336 Symbiobacterium thermophilum
Q8RC85 326 GIGYVWDAITIKW 338 Caldanaerobacter subterraneus subsp. tengcongensis
Q63CM4 319 GTGYTWAATVIRW 331 Bacillus cereus E33L
Q67MB7 330 GTGYTWAATAIRW 342 Symbiobacterium thermophilum
Q847B9 325 AAGFSWAALTVKY 337 Nodularia spumigena
Q7NZW4 305 AMGFSWGITAVEY 317 Chromobacterium violaceum
Q6AQA3 332 GSGIN--SIVLGI 342 Desulfotalea psychrophila
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap