Conserved Protein Domain Family
AAA_3

?
pfam07726: AAA_3 (this model, PSSM-Id:116340 is obsolete and has been replaced by 429622)
ATPase family associated with various cellular activities (AAA)
This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.
Statistics
?
PSSM-Id: 116340
Aligned: 55 rows
Threshold Bit Score: 241.678
Threshold Setting Gi: 81858933
Created: 29-Mar-2013
Updated: 4-Apr-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7UYM5  76 HCILQGMPGLAKTMMVSTLASLTDLSFRRVQFTPDLMPGDITGTEVLEEDHttgkRIFRFVEGPLFGNVILADEINRTPP 155 Pirellula sp.
Q81P05  32 HVLLEDVPGTGKTLLAKTLSKSIGGNFSRVQFTPDVLPSDVTGIEYFNPKT----SEFELRLGPVVANILLADEINRAMP 107 Bacillus anthracis
Q81NY3  34 HILLEDVPGTGKTTLAKSLAKSVDAKFQRIQFTADTLPGDVIGLEYFNVKE----SDFKTRLGPIFANIVLVDEINRAVP 109 Bacillus anthracis
Q8G520 181 HILLEDNPGTGKTQLARGLANSISTGFKRVQFTPDLLPSDVVGVTFYDQKR----GEFEFREGPIFASIVLADEINRASP 256 Bifidobacterium longum
Q9K4W2  57 HLLIEDVPGTGKTTLARCLAASLEADWHRVQFTPDLLPSDITGVTVYRQNT----GTFEFLPGPVFANIVLGDEINRASP 132 Streptomyces sparsogenes
Q898T1  27 HILIEDVPGIGKTTLVKALAKSLQLQYKRIQFTTDLLPSDILGISIYNDKQ----RDFEFRKGPIFSNIILADEINRTSP 102 Clostridium tetani
Q9S2W2  39 HLLIEDVPGVGKTMLAKALARSIDCSVRRIQFTPDLLPSDITGVSIWDQQR----RDFEFKPGAIFAQVVIGDEINRASP 114 Streptomyces coelicolor
Q81RC7  41 HVLLEDVPGVGKTMLVRALSKSIDADYKRIQFTPDLLPSDVTGVSIYNPKE----LQFEFKPGPIMGNFILADEINRTSP 116 Bacillus anthracis
Q9HSH7  40 HVLLEDVPGTGKTLTARSVATALGLEFSRVQFTPDLLPTDVLGTHVFNERS----REFEFRPGPVFANVVLADEINRAPP 115 Halobacterium salinarum
O53314  42 HVLIEDLPGLGKTLIARSFAAALGLDFTRVQFTPDLLPADLLGSTIYDMQS----GRFEFRAGPIFTNLLLADEINRTPP 117 Mycobacterium tubercu...
Q81P05  32 HVLLEDVPGTGKTLLAKTLSKSIGGNFSRVQFTPDVLPSDVTGIEYFNPKT----SEFELRLGPVVANILLADEINRAMP 107 Bacillus anthracis
Q81NY3  34 HILLEDVPGTGKTTLAKSLAKSVDAKFQRIQFTADTLPGDVIGLEYFNVKE----SDFKTRLGPIFANIVLVDEINRAVP 109 Bacillus anthracis
Q8G520 181 HILLEDNPGTGKTQLARGLANSISTGFKRVQFTPDLLPSDVVGVTFYDQKR----GEFEFREGPIFASIVLADEINRASP 256 Bifidobacterium longum
Q9K4W2  57 HLLIEDVPGTGKTTLARCLAASLEADWHRVQFTPDLLPSDITGVTVYRQNT----GTFEFLPGPVFANIVLGDEINRASP 132 Streptomyces sparsogenes
Q898T1  27 HILIEDVPGIGKTTLVKALAKSLQLQYKRIQFTTDLLPSDILGISIYNDKQ----RDFEFRKGPIFSNIILADEINRTSP 102 Clostridium tetani
Q9S2W2  39 HLLIEDVPGVGKTMLAKALARSIDCSVRRIQFTPDLLPSDITGVSIWDQQR----RDFEFKPGAIFAQVVIGDEINRASP 114 Streptomyces coelicolor
Q81RC7  41 HVLLEDVPGVGKTMLVRALSKSIDADYKRIQFTPDLLPSDVTGVSIYNPKE----LQFEFKPGPIMGNFILADEINRTSP 116 Bacillus anthracis
Q9HSH7  40 HVLLEDVPGTGKTLTARSVATALGLEFSRVQFTPDLLPTDVLGTHVFNERS----REFEFRPGPVFANVVLADEINRAPP 115 Halobacterium salinarum
O53314  42 HVLIEDLPGLGKTLIARSFAAALGLDFTRVQFTPDLLPADLLGSTIYDMQS----GRFEFRAGPIFTNLLLADEINRTPP 117 Mycobacterium tubercu...
Q7UYM5 156 KTQSALLEAMQEHQLTVCGKTYKLPDPFFVLATQNPVETEGTYPLPEAQLDRFLL 210 Pirellula sp.
Q81P05 108 RTQSSLLEAMEERQVTLEKQSTPLPKPFFVIATQNPIESQGTFPLPDAQLDRFLM 162 Bacillus anthracis
Q81NY3 110 RTQSSLLEVMEERTVTIAKQTHSLPEPFLVIATQNPLESAGTFPLPDAQLDRFLL 164 Bacillus anthracis
Q8G520 257 KTQSALLEVMEEQKVTVDGVTHDVPQPFIVIATQNPIEQLGTYKLPEAQMDRFLI 311 Bifidobacterium longum
Q9K4W2 133 KTQSAMLEVMEERQVTADGSTHPVPRPFMVIATQNSVDMGGTYPLPEAQLDRFLM 187 Streptomyces sparsogenes
Q898T1 103 KTQSALLEVMEEKQVTEGNETYKLQEPFIVIATQNPIEFEGTFILPEAQLDRFII 157 Clostridium tetani
Q9S2W2 115 KTQSALLESMEERQVTIDGQTYELPSPFMVVATQNPVEMEGTYPLPEAQRDRFMA 169 Streptomyces coelicolor
Q81RC7 117 KTQSALLESMEEGNITIDGMTRPLPKPFFVMATQNPVEYEGTYPLPEAQLDRFLL 171 Bacillus anthracis
Q9HSH7 116 KTQAALLEAMEEGQVTIDGETMALPEPFFVIATQNPVDQEGTFPLPEAQLDRFVV 170 Halobacterium salinarum
O53314 118 KTQAALLEAMAEGQVSIDGQTHKLAMPFIVLATDNPIEYEGTYPLPEAQLDRFAI 172 Mycobacterium tuberculosis
Q81P05 108 RTQSSLLEAMEERQVTLEKQSTPLPKPFFVIATQNPIESQGTFPLPDAQLDRFLM 162 Bacillus anthracis
Q81NY3 110 RTQSSLLEVMEERTVTIAKQTHSLPEPFLVIATQNPLESAGTFPLPDAQLDRFLL 164 Bacillus anthracis
Q8G520 257 KTQSALLEVMEEQKVTVDGVTHDVPQPFIVIATQNPIEQLGTYKLPEAQMDRFLI 311 Bifidobacterium longum
Q9K4W2 133 KTQSAMLEVMEERQVTADGSTHPVPRPFMVIATQNSVDMGGTYPLPEAQLDRFLM 187 Streptomyces sparsogenes
Q898T1 103 KTQSALLEVMEEKQVTEGNETYKLQEPFIVIATQNPIEFEGTFILPEAQLDRFII 157 Clostridium tetani
Q9S2W2 115 KTQSALLESMEERQVTIDGQTYELPSPFMVVATQNPVEMEGTYPLPEAQRDRFMA 169 Streptomyces coelicolor
Q81RC7 117 KTQSALLESMEEGNITIDGMTRPLPKPFFVMATQNPVEYEGTYPLPEAQLDRFLL 171 Bacillus anthracis
Q9HSH7 116 KTQAALLEAMEEGQVTIDGETMALPEPFFVIATQNPVDQEGTFPLPEAQLDRFVV 170 Halobacterium salinarum
O53314 118 KTQAALLEAMAEGQVSIDGQTHKLAMPFIVLATDNPIEYEGTYPLPEAQLDRFAI 172 Mycobacterium tuberculosis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap