Conserved Protein Domain Family
DUF1143

?
pfam06608: DUF1143 (this model, PSSM-Id:115278 is obsolete and has been replaced by 284112)
Protein of unknown function (DUF1143)
This family consists of several hypothetical mammalian proteins (from mouse and human). The function of this family is unknown.
Statistics
?
PSSM-Id: 115278
View PSSM: pfam06608
Aligned: 2 rows
Threshold Bit Score: 309.701
Threshold Setting Gi: 47605544
Created: 29-Mar-2013
Updated: 4-Apr-2013
Structure
?
Aligned Rows:
pfam06608 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75076187   2 AASQCLCCSKFLLQRQNLACFLTNPHCGSIINADGHGEVWTDWNNMSKFFQYGWRCTTNENAYSNRTLMGNWNQERYDLR 81
gi 47605544   1 MAVSCSLNHSTYLQRQNLVCYLRNPHYGSLIYADGHGEVWTDWNDMSKFLQYGWRCTTNENSYSNRTLVGNWNQERYDLK 80
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 75076187  82 NIVQPKPLPSQFGHYFETTYDTSYNNKMPLSTHRFKREPHCFPGHQPELDPPRYKCTEKSTYMNSYSKS 150
gi 47605544  81 NIVKPKPLPSQFGHAFETTYDANYSRKKPQSTHRFKREPHWFPGHQPELDPPHYKCTAKSTYMTNYSEP 149
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap