Conserved Protein Domain Family
PspA_IM30

?
pfam04012: PspA_IM30 (this model, PSSM-Id:112811 is obsolete and has been replaced by 281941)
PspA/IM30 family
This family includes PspA a protein that suppresses sigma54-dependent transcription. The PspA protein, a negative regulator of the Escherichia coli phage shock psp operon, is produced when virulence factors are exported through secretins in many Gram-negative pathogenic bacteria and its homologue in plants, VIPP1, plays a critical role in thylakoid biogenesis, essential for photosynthesis. Activation of transcription by the enhancer-dependent bacterial sigma(54) containing RNA polymerase occurs through ATP hydrolysis-driven protein conformational changes enabled by activator proteins that belong to the large AAA(+) mechanochemical protein family. It has been shown that PspA directly and specifically acts upon and binds to the AAA(+) domain of the PspF transcription activator.
Statistics
?
PSSM-Id: 112811
View PSSM: pfam04012
Aligned: 11 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Dec-2011
Updated: 5-Jan-2012
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam04012 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158517772   3 NPFVKAWKYLMALFSSKIDEHADPK--VQIQQAIEEAQRTHQALTQQAAQVIGNQRQLEMRLNRQLADIEKLQVNVRQAL 80
gi 81787433    1 MVFDRMKNLVLASIHEGLDKLEDPE--MMLNQYIRNVQSEMGRAEKAIEEQKKLHVSLERDLEEAKRLMKRREEQAKAAL 78
gi 3123166     1 MVLKRIRDMFVASVHEGLDKMENPK--VMLNQYVRDMESDIAKAKQTIVKQHTIAYQFKKKYEEAAEVAGKRKNQAQLAF 78
gi 3123076     2 GLFDRLGRVVRANLNDLVSKAEDPE--KVLEQAVIDMQEDLVQLRQAVARTIAEEKRTEQRLNQDTQEAKKWEDRAKLAL 79
gi 81671555    2 ELFNRVGRVLKSQLTHWQQQQEAPE--DLLERLLGEMELELIELRRALAQTIATFKSTERQRDAQQLIAQRWYEKAQAAL 79
gi 81544845    2 GIFSRFADIVNSNISALLDKAEDPE--KMIRLIIQEMEDTLVEVRTNSAKAMADKKELARKVESIEQQLEDWQNKATLAL 79
gi 44888313    2 SIFDRLSRLLRANVNDMISKAEDPA--KIIDQALRDMRSAYADARNEVAGAMAQAAKLEREAGTNSKLAAEYEKKAEEAL 79
gi 81343836    3 GLLKRLLRVVRAEAHSVVEKLEDPI--KITEEGLRELRKQLKEAMEALAQVKASQIRFEREARNEKERAKALVKKAESLL 80
gi 81534980    2 SIWSKLSALFRGAAHDGAQTVVDANalRILDQEIRDADSAQGKARDELAKLVARRRALETEVAQLTDQSRKYESSARAAM 81
gi 81540230    2 TVWSKLLSALRGGANEVGEAIVDSQalRILDQEIRDADVELRKSREALASIMARHRLAQERVEKGAAQVAEYEQYAIKAL 81
gi 84028069    2 GILKSLFTLGKSFISQAEESIEETQgvRMLEQHIRDAKAELDKAGKSRVDLLARVKLSHDKLKDLRERKASLEARALEAL 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158517772  81 TLAdqataagdaakateYNNAAEAFAAQLVTAEQSVEDLKTLHDQALSAAAQAKKAVERNAMVLQQKIAERTKLLSQLEQ 160
gi 81787433   79 SAG--------------EEELAKKALYSKKNAAEQVARYEALMQKSHDHVLELRLQLEDLEKKYEQLRDKKRELLLRSQS 144
gi 3123166    79 DAG--------------EEELAKKALTEMKYLEGKAAEHKASYEQANSQLADLKEQLAALETKLQDVKDKKQALIARANA 144
gi 3123076    80 TNG--------------EENLAREALARKKSLTDTAAAYQTQLAQQRTMSENLRRNLAALEAKISEAKTKKNMLQARAKA 145
gi 81671555   80 DRG--------------NEQLAREALGQRQSYQSHTEALGKSLGEQRALVEQVRGQLQKLERKYLELKSQKNLYLARLKS 145
gi 81544845   80 TKQ--------------REDLARAALIEKQKLQHVLKGLHTEQMLVEETIEKLTGEIGKLETKITETRAKQQALAIRSQA 145
gi 44888313   80 RGG--------------SEDLAREALRRAQNHKDLAKGFDEQRTVQQSTVDQLKTQLRALEAKIDEMESKKTLLAARQKT 145
gi 81343836   81 LQAqegki-----speeAEKLAAELIQKAELHEKNARRLEEEAKRQREMAVKLQAKIDELKVQIAKYEAELKTLKARLAT 155
gi 81534980   82 NKG--------------DQALALEVAQRIADLEKDAGQKSTQMTELRAAEEKLRTVIAQTDTKVEALRREIEIVKVNESV 147
gi 81540230   82 EAG--------------NEELAREVAEKIATLENQLEGERAQVAEFAASVAQLRKSVSQAEGNIRQLKQQVDTVKATESV 147
gi 84028069   82 SKNv-------------NPSLINEVAEEIARLENLITAEEQVLSNLEVSRDGVEKAVTATAQRIAQFEQQMEVVKATEAM 148
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158517772 161 AKMQEQVSASLRSMSelaAPGNTPSLDEVRDKIERRYANAIGSAELAe---------sSVQG----RMLEVEQAGIQMAG 227
gi 81787433  145 IKAFEQMKKARATFS---TEGSERQFQRMEEKIEDMELRESAREGRRg----------FSVD----YDEQVEQEFLNMKK 207
gi 3123166   145 AKAKEHMNTTFDKID---SESAYREFLRIENRIEEMEIRANYSKSAEa---------gTELT----RKEFADDVEAEIEK 208
gi 3123076   146 AKANAELQQTLGGLG---TSSATSAFERMENKVLDMEATSQAAGELAgfgienqfaqlEASSgvedELAALKASMAGGAL 222
gi 81671555  146 AIAAQKIEEIAGNLD---NASASSLFERIETKILELEAERELLNPPP-----------SPL------DKKFEQWEEQQAV 205
gi 81544845  146 ASHRRDVQRHLHAGR---TEEAMAKFEQFSRKVDELEAEADLYAQSG-----------QARS----LEQEFAELQAQDEI 207
gi 44888313  146 AQAGETLDRVSGFSK---AGGAMDAFNEMEQKVAGMEDRNKAMGELR-----------NDQd----FDAQLKDLGRDKDV 207
gi 81343836  156 ARAVKKVNKQIAKVD---PSDTIAMLERMKEKVEEEETLAQAYEELAk----------QEVA----LDVESEAEKKLKEV 218
gi 81534980  148 QKAQAAVISRSGSASg-vVGSAADSLKRIKERQAVREEQFRLHSESE-----------DRKTga-dLDAKLAAAGILPGA 214
gi 81540230  148 QKAQMAVAQRYGNSKs-kLQTAVDSLERIKQRQAERAATMDAAAELA-----------SAAApddaLDAKLRAAGIKASG 215
gi 84028069  149 QRAQQAVTTSTVGASs-sVSTAAESLKRLQTRQAERQARLDAAAQLE-----------KVADgr-dLDEKLAEAGIGGSN 215
                        250
                 ....*....|....*..
gi 158517772 228 hsrlEQIRASMRGEALP 244
gi 81787433  208 ----SLVDTKNASEQAQ 220
gi 3123166   209 ----MRTLSLQKSDQTK 221
gi 3123076   223 pg-tSAATPQLEAAPVD 238
gi 81671555  206 ----EATLAAMKARRSL 218
gi 81544845  208 ----EKELNKLKA-QMK 219
gi 44888313  208 ----DDALAALKA-KVQ 219
gi 81343836  219 e--sKQKLEELKKRLGL 233
gi 81534980  215 sg-aEDVLARLMAPKNE 230
gi 81540230  216 ns-vDGVLARLKE-KGK 230
gi 84028069  216 kssaQDVLARLQRQQGE 232
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap