Conserved Protein Domain Family
alpha_tubulin

?
cd02186: alpha_tubulin (this model, PSSM-Id:100015 is obsolete and has been replaced by 276955)
Click on image for an interactive view with Cn3D
The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa. The alpha- and beta-tubulins are the major components of microtubules, while gamma-tubulin plays a major role in the nucleation of microtubule assembly. The delta- and epsilon-tubulins are widespread but unlike the alpha, beta, and gamma-tubulins they are not ubiquitous among eukaryotes. The alpha/beta-tubulin heterodimer is the structural subunit of microtubules. The alpha- and beta-tubulins share 40% amino-acid sequence identity, exist in several isotype forms, and undergo a variety of posttranslational modifications. The structures of alpha- and beta-tubulin are basically identical: each monomer is formed by a core of two beta-sheets surrounded by alpha-helices. The monomer structure is very compact, but can be divided into three regions based on function: the amino-terminal nucleotide-binding region, an intermediate taxol-binding region and the carboxy-terminal region which probably constitutes the binding surface for motor proteins.
Statistics
?
PSSM-Id: 100015
View PSSM: cd02186
Aligned: 43 rows
Threshold Bit Score: 652.819
Threshold Setting Gi: 118375994
Created: 31-Jul-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 30 residues -Click on image for an interactive view with Cn3D
Feature 1:nucleotide binding site [chemical binding site]
Evidence:
  • Comment:In alpha-tubulin, N-site (non-exchangeable) buried at monomer-monomer interface within dimer
  • Structure:1FFX_C: binds GTP (defined using 4.5 A contacts)
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                ###  ##                                                               ##
1FFX_C         2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGqmpsdkti-----------gggddsfnTFFSETGAGKHVPRAVFVDL 70
gi 118396516   2 EEIISIHIGQSGIQVGNSCWELFCLEHQIQPDCkiiqnqk--------------nedlktNFFSETQSGQFVPRSVYLDL 67
gi 417851      3 REIISIHIGQAGVQVGNSCWELYCLEHGIERDGsipadrkqssd------vnnlnkdlgtFFSESTNGKKVVPRAIFLDL 76
gi 135421      2 REVVSIQIGQCGIQIGNACWELYLLEHGINLDGslktkeeltasgssasvghdtsandarTFFTETGNGKQVPRSIFVDL 81
gi 401160      2 REVITINIGQAGCQLGNKCWELFCLEHGIQPDGtaiansnekrs-----vitggidtaynAFFQELQNGRHVPRAIFVDT 76
gi 31324246    2 KEIICINIGQAGIQMANAIWELFCQEHGITADGkmrsgltd------------gdsrafnTFFFQSPSDQYVPRVLSIDL 69
gi 51701891    2 REIISLHIGQAGVQIGNACWELYCKEHGILPNGqldqnkm--------------ddesaeSFFSPTSVGTYVPRTLMVDL 67
gi 24647815    5 GEIIQIHIGQAGVQIANACWELFCLEHGILANGrltqspm--------------ddsfltFFEFTSHQPCVQPRLVMIDT 70
gi 32812838    2 KEVISIHVGQGGIQLGDSCWEQLCLEHGIQPNGlmqreisn------------qedsefyKFYSENSKGNFVPRSLFIDS 69
gi 156138750   2 REVISINVGQAGIQMANAAWELFCIEHGIEADGklrdserf------------aqnvgfhTFFQEVPSGNFVPRAINIDL 69
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        #  #                        ###                                      #######    
1FFX_C        71 EPTVIDEVRtGTYRQLFHPEQLITGKEdAANNYARGHYtiGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFT 150
gi 118396516  68 DSNSIDEVKvGSQKQLFNHEFLVSKNDeKANTFARGNYqvSSEFIEFCLDKVRRLTESCQNLQGFLIYNSAGGGTGSGFG 147
gi 417851     77 EPTVIDEIRtGDYKNLFHPEQLITGKEdAANNYARGHYtvGKELIDVCVDRIRRLADQCDGLQGFLVFHSVGGGTGSGFG 156
gi 135421     82 EPTVIDDVRnGCMRELYHPEQLISGKEdAANNYARGRYsiGKEVIDRVTSRLQKIAEQCDSLQGFLIFHSLGGGTGSGFT 161
gi 401160     77 EPTVIDEIKtGEYCGLYHPEHLICGKEdASSNFAKGKTg-YEPLLNQTMDAIRKATENCTGLQGFFIYNSVGGGTGSGFT 155
gi 31324246   70 EPTVVDEIRtGTYRQLFHPDSLINGEEdAASNFARGHFtiGKSIIDVAMAQLRKVVDNCDGLEGFLMISSYGGGTGSGFQ 149
gi 51701891   68 EPGVLDSIKtGKYRELYHPGQLISGKEdAANNYARGHYtvGKEIIEPAMEQIRRMADSCDGLQGFLIYHSFGGGTGSGFA 147
gi 24647815   71 EPTVIDEIRtGSYRNLFHPDTLITGKDdSGSNFARGYNlmASELLDRSMNAIRRVADRCRNLRGFLVFRAIGGGSGSGLG 150
gi 32812838   70 ESEAISKVKdGKYRELFSQNSFIYGKEdASNNFARGYYqiGKEYIDVSLERVRKLAEDCQSPQGILLFNSVGGGTGSGLG 149
gi 156138750  70 EPTVIDEIRtANYRHLWHPDYLINCCEdAANNFARGHFtvGKNVIERFLDQLRKCVHACQSVQGFIVLNSYGGGTGSGLS 149
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                             # ##       ##                      #   #             #  ## 
1FFX_C       151 SLLMERLSVDYGKKs-KLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIerPTYTNLNR 229
gi 118396516 148 SLLTKKIKQNYNKKs-VLGFTIYPSDKTQTNEFEPYNSVLYSQNLIENGDVNLVFDNEAIYDICNMNPYIsnIAYTDLNR 226
gi 417851    157 SLLLQKLALDYGGKksKLDFCVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVSFMLDNEAIYNICKNSLDIekPTYTNLNR 236
gi 135421    162 SLLVERLSTDYSKKc-KLDFAVYPSPKVSTAVVEPYNALLTTHSTMDHSDCVFMVDNEAIYDICNNSLGVdrPAYRNLNR 240
gi 401160    156 AALCEKLADKYTKKt-KLNTVIWPSPKLSSGVVEPYNAVLNTHAMMKFVNCTFMVDNESIYKICQKQLGVhsPSYFHLNQ 234
gi 31324246  150 TLMLEKIGIEYAKRl-KISVVIYPCPKLSTSTVEPYNAVLTSHFTLEQGELSVFFDNESMYDICTKTLDInrPTYSNLNR 228
gi 51701891  148 SLMMDRLAAEFGKKs-KLEFSVYPAPKIATAVVEPYNSILTTHTTLDYSDCSFLVDNEAIYDMCRNLGIQr-PYYTDINR 225
gi 24647815  151 TRIMERLVEDFGKKmtVVEFLVYPSPSISPVIVEPYNALLAAHFSMDCADVSFIVDNEALYDICANTLNVpaPTYTNLNR 230
gi 32812838  150 TLLLERLQEDYLKQi-RIGINIYPYPNNDTAIIESYNAILATQYLQKFADVCILFDNQAVYGICNNALDIqnPSYTNLNR 228
gi 156138750 150 ALIFEHLDIEYSQSa-KFQQCIYPAPQLATAIVEPYNALLSASKSIEHTDVVMLIDNEATFEICTRQLSIsrPVYNNLNR 228
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         #                                                                              
1FFX_C       230 LIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRAHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVK-CDPR 308
gi 118396516 227 VIAQAVSQLTCGLRFDDEQQNHLSDFEKNLIPYPKFCFMLSSYSPFIFTQQINSIQLSTQEISSFLFEPSNMMAK-CNPS 305
gi 417851    237 LIAQVISSLTSSLRFPGQLNLDINDIQTNLVPFPRLHFVLCSYAPVISREKAHHETITVDNITSAVFSEKNIMAK-CQPN 315
gi 135421    241 LIAQIVSSTTASLRFSGSMNVDLNEFQTNLVPFPRIHFPLVAYAPLMSAERSAHEQHAITTLTNACFESSNMMVK-CDPR 319
gi 401160    235 LIAQAMSSITASLRFEGTLNVDLNEFPTNLVPFPRDHFAMMSYAPIVTPEKAIRQTLSVQELTSSLFDPNSLMIQcDDIN 314
gi 31324246  229 LLAQIYSAITVSLRYESSLNANLSQIVTNLIPYPRIHFSMVNYSPIVSAQRAAHEQFSVVELTRNVFEPGSQLLR-VNMK 307
gi 51701891  226 VIAQVVSSITASLRFPGSLNVDLTEFQTNLVPYPRIHFPLVAYSPMLSKEKAAHEKLSVQEITNACFEPQNQMVR-CDTR 304
gi 24647815  231 IIAQVVSSFTASQRFGGGSTVSFQELQTNLVPYPRIHYPLINYAPLVPISHSQFVNMSTAQLTGQCFQMSNQMVR-CNPS 309
gi 32812838  229 LIAQVYSSLTAAIRFNGSLYSDISEFQTNLVLHPRLHFMLCSYSPILSNYKTCFQQPITTDISIEAFEPQNMMVK-CNPQ 307
gi 156138750 229 LLAQIFSAMTVSIRFGSSLNHDLLQLQTNLVPYPRIHFPAVNYAPILDPHRANHEKLSITEITRELFESSNQLIK-CDLR 307
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
1FFX_C       309 HGKYMACCLLYRGDVV-PKDVNAAIATIKTKr--tIQFVDWCPTGFKVGINYEPPTvvpggdlaKVQRAVCMLSNTTAIA 385
gi 118396516 306 FGKYMAVDITYRGAGIvPKHIGQSFNSWKEKk--tLQFVNWCQSYIKLKAIYNIPCivpqssfaYSNKSVFMVSNSTSIS 383
gi 417851    316 LGKYMACCLMYRGDIV-PKEAQKAVQNIRSEksrnVSFVDWSPTGFKCGINNQAPVstkdsemaEVKKSVCMLSNTTAIS 394
gi 135421    320 AGKFMACCMLYRGDVV-PKDVNAAVSAIKSKr--hIQFVDWCPTGFKIGINYEKPAfvpdgdlaKTSRACCMLSNTTAIS 396
gi 401160    315 KGKFMSCCMMYRGDVS-SREVNLAVSGIKKQn--tVPFVGWCPCSFKCGINSQPATavpgssyaSTARSACMIANHTAMC 391
gi 31324246  308 VGKYMSCCLQYRGDIT-PRAVNEAIFEIKRRt--dIKFVDWCPTGFKIGINSQPPTlipgsglaPSKSSVTMITNSTAIV 384
gi 51701891  305 KGKYMACCLLFRGDVN-PKEANNATANVKAKr--tNQFVEWCPTGFKVGINSRKPTvldgeamaEVSRAVCALSNTTAIS 381
gi 24647815  310 HGKYMASVLLYRGDIA-PNEINTALENIKRNr--sFRFVDWSPTGFKIGVSPMPPYyvpggdlaPTNRACVAISNNTNIR 386
gi 32812838  308 KGKFMACSILYRGDVI-PRDVRLSLSKLSVQk--tIQFVDWCPTKFKVGITYKDHFiipngeiaKVVRSACMISNTTAIY 384
gi 156138750 308 LGKYMSCCIQYRGLIT-PRQVNLGVYEIKRRt--dISFVDWCPTGFKLGISPMPPTivpgseiaPTERNCTMFCNTTAVA 384
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|
Feature 1                                                          
1FFX_C       386 EAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEV 435
gi 118396516 384 EVFSRINNRFDQMFTKRQFTHLYQSEGMEEGELIQAREDLALLENDYQDA 433
gi 417851    395 QVFSRINHKFDLMFVKRAFVHWYVGEGMEEGEFAEARDDLLALEKDYESV 444
gi 135421    397 VAFSNLSYKFDLMFKKRAFVHWYVGEGMEEGEFTEARENIAVLERDFEEV 446
gi 401160    392 QVFQKVNQNFDLMFGKRAFVHHYVGEGMEENEFTDARQDLYELEVDYANL 441
gi 31324246  385 TMWENINKKFTLLFNKRAFVHWYVGEGMEEGEFNEAIDNISYLLKDYKEV 434
gi 51701891  382 EAWKRLNNKFDLMFSKRAFVHWYVGEGMEEGEFSEAREDLAMLEDDYERI 431
gi 24647815  387 IAWCRLVNKFDKLYQRRAFVYHYVGEGLEEGNFNEASENICQLVHDYLEV 436
gi 32812838  385 DIFPKFTHAFDQMFSRRAFVHWYLKEGMEEFQFIEAREELAALEKDYEEV 434
gi 156138750 385 QVWQRLDKKFDLLFNKRAFVHWYVGEGMEEGEFVEARDDLIKLEKDYEEI 434

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap