Conserved Protein Domain Family
Spg1

?
cd04128: Spg1 
Septum-promoting GTPase (Spg1)
Spg1p. Spg1p (septum-promoting GTPase) was first identified in the fission yeast S. pombe, where it regulates septum formation in the septation initiation network (SIN) through the cdc7 protein kinase. Spg1p is an essential gene that localizes to the spindle pole bodies. When GTP-bound, it binds cdc7 and causes it to translocate to spindle poles. Sid4p (septation initiation defective) is required for localization of Spg1p to the spindle pole body, and the ability of Spg1p to promote septum formation from any point in the cell cycle depends on Sid4p. Spg1p is negatively regulated by Byr4 and cdc16, which form a two-component GTPase activating protein (GAP) for Spg1p. The existence of a SIN-related pathway in plants has been proposed. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.
Statistics
?
PSSM-Id: 206701
Aligned: 11 rows
Threshold Bit Score: 315.873
Threshold Setting Gi: 28396142
Created: 30-Aug-2005
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
  next features
Feature 1:GTP/Mg2+ binding site [chemical binding site]
Evidence:
  • Comment:Based on sequence similarity with other Rab isoforms.
  • Comment:The active conformation of Rab is stabilized by interations between the gamma phosphate of GTP and two critically conserved residues, Thr in switch I and Gly in switch II

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

Feature 1             #######         #       ##                         #                    
P87027     11 IKVGMIGDSSIGKTSLMVTYVQGSFD.[3].TQTLGVNFMEKTISIRNTEITFSIWDLGGQREFV     NMLPMVCNDA 83  fission yeast
CAI77247   36 LKVGMVGDSQIGKTSLMVRYVEGSFN.[3].IQTLGVNFMEKTISIRNTEITFSIWDLGGQREFV     NMLPLVCNDA 108 Ustilago maydis 521
EAL02421   41 LKIGLIGDSQIGKTSLMVKYVEGSFD.[3].IQTLGVNFMDKKIQIRNTTITFSIWDLGGQKEFI     NMLPLVSNDA 113 Candida albicans SC5314
XP_635107  19 VKVGMVGDSQIGKTSLMVKYVEGTFD.[3].IQTLGVNFMEKTISIRGTEITFSIWDLGGQREFV     NMLPLVCNDA 91  Dictyostelium discoideu...
XP_657549   6 LKIAMVGDAGVGKTSLMVKYVEGNFD.[3].IQTLGVNCMEKTISLKGKEVTFSVWDLGGQREYI     TMLPMVMDGA 78  Entamoeba histolytica H...
AAO39054   17 VKIALLGNAEAGKTSLMVRYVEGEFN.[3].IQSLGVNFMERTITLHDNPVLLSIWDLGGESEFK     NMLPLVCDGS 89  Giardia intestinalis
P38987     21 VQVGLVGDAQVGKTSLMVKYVQNIYD.[3].TQTLGVNFLKRKVSIRSTDIIFSIMDLGGQREFI     NMLPIATVGS 93  baker's yeast
BAC79616  113 LKVSLLGDCQIGKTSFMVKYVGDDEE.[3].LQMTGLNLMDKTLAVRGARIAFSIWDVAGDSQFL     DHVPIACKDA 185 Japanese rice
BAB02832  107 LKISLLGDPEIGKTSFLAKYVGEEKE.[4].ELEKGINCTDKTLYMGGARISYSIWELEGAERSR     DQIPVACKDS 180 thale cress
BAB08763  102 LKISLLGDCQTGKTTFVVKYVGDENQ.[2].LEMTGLNLMDKTFYVQGVTISFSIWDVGGDEKRS.[1].DHIPIACKDA 174 thale cress
CAH02151   17 VKVGLIGDAQVGKTSLMVKYVQNVFD.[3].TQTLGVHYLERKVVLGSTDVIFSIMDLGGQREFI     NMLPLVSEGA 89  Kluyveromyces lactis NR...

Feature 1                                           ## #                                  ### 
P87027     84 VAILFMFDLSRKSTLNSIKEWYRQARGFNKTAVPILIGTKYDHFMTFPREDQEEITKQARRYAKAM.[2].SLVFCSTSH 160 fission yeast
CAI77247  109 VAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHYATLPREEQDEITKQARRFSKAM.[2].PLIFCSTSH 185 Ustilago maydis 521
EAL02421  114 VAILFMFDLTRKSTLNSIKEWYRQVRGFNKTAIPFLVGTKYDQFIDLSFQDQIEITQQAKKFGSAM.[2].PVIFCSTSH 190 Candida albicans SC5314
XP_635107  92 VAILFMFDLSRKSTLNSVKEWYRQARGFNKTAIPFLIGTKFDVFATKPIEEQEEITKQARKFASAM.[2].PLIFCSTSH 168 Dictyostelium discoideu...
XP_657549  79 RVILFFFDLTRVMTLNNIKDWYKEARAHNNSASCILVGTKYDLFADLDATEKSRITATALKYAQAM.[2].SCVFCSSSQ 155 Entamoeba histolytica H...
AAO39054   90 MVFLYIFDLTSKTSLASIKEWYRQAKALNRSAFPVLVGAKYDRFRELREDKKREIIEHARRYSKAM.[3].PLVFTSAEL 167 Giardia intestinalis
P38987     94 SVIIFLFDLTRPETLSSIKEWYRQAYGLNDSAIPILVGTKYDLLIDLDPEYQEQISRTSMKYAQVM.[2].PLIFCSTAK 170 baker's yeast
BAC79616  186 VAILYMFDLTSRCTLTNVIDWYERARKWNKTAIPILIGTKFDDFAQLPLEMQWTIVNEARAYARAM.[2].TLFFSSSTH 262 Japanese rice
BAB02832  181 VAILFMFDLTSRCTLNSVISWYQQARKSNQTAIPVMVGTKFDEFIQLPIDLQWTIASQARTYAKAL.[2].TLFFSSASY 257 thale cress
BAB08763  175 VAILFMFDLTSRSTLNSVFGWYSQARKWNKTAIPILIGTKFDDFVRLPPNLQWTIVTQARAYAKVM.[2].SLFFSSATH 251 thale cress
CAH02151   90 VAIVFLFDLTRPETLNSIKEWYRQARGFNDTAISILVGTKYDLFVDMDPEYQENVSRTAMKYAQVM.[2].PLIFCSTQS 166 Kluyveromyces lactis NR...

Feature 1                                     
P87027    161 SINVQKIFKIVLAKVFDLKCTIPEIKNVGDPI 192 fission yeast
CAI77247  186 AINVQKIFKVLLAKAFDLKCTIPEIKGPGEPL 217 Ustilago maydis 521
EAL02421  191 SINVQKIFKIILSKAFDLKLNLDEIVNVGEPI 222 Candida albicans SC5314
XP_635107 169 SINVQKIFKIVISKAFDLNCTIPKVVGVGEPL 200 Dictyostelium discoideum AX4
XP_657549 156 GINIQNVFKVSLAKVFGLTLNVPQTTEGAVLV 187 Entamoeba histolytica HM-1:IMSS
AAO39054  168 GVNINRLFKLVVCLVFGLNPGIEQIEADDQPI 199 Giardia intestinalis
P38987    171 SINIQKIFKIALAKIFNLTLTIPEINEIGDPL 202 baker's yeast
BAC79616  263 NINVNKIFKFITAKLFNLPWTVERNLTVGEPI 294 Japanese rice
BAB02832  258 NINVNKIFKFVTAKLFDLPWTVERNLTIGEPI 289 thale cress
BAB08763  252 NINVNKIFKFILARLFNLPWKIDRNLTLGEPI 283 thale cress
CAH02151  167 SINVQKIFKVVIAKAFNLTLKVPEYKQIGEPL 198 Kluyveromyces lactis NRRL Y-1140

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap