Conserved Protein Domain Family
HAD_2

?
pfam13419: HAD_2 
Haloacid dehalogenase-like hydrolase
Statistics
?
PSSM-Id: 315982
View PSSM: pfam13419
Aligned: 51 rows
Threshold Bit Score: 126.541
Threshold Setting Gi: 0
Created: 28-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

gi 122265225    7 ALFDLDNTLLKTEDASVAALTYAL.[ 9].QAIVELMGLPGIDMARELGSS      NPAKTIDIFNERINQ.[4].IKE 82
38_pfamImport   1 VVFDVDGTLISSAKLVEDSMMETL.[10].EDIKKFYGPDEVGMLRGLLKN.[ 6].AFKEYLQHYEENDLT.[2].PKL 81
10_pfamImport   1 VIFDLDGTLLNRDVSIQKFIEYQY.[13].SYIARFIELDNRGYVWKDAVY.[12].TWEDLLEDYMNHFHK.[1].CAP 89
21_pfamImport   1 IIFDVDGTLLSTESMYITALAETL.[ 9].AELHHVFGLPGPESLEYLKIP      NPELIQADWIARLDD.[4].IFL 76
13_pfamImport   1 IVFDLDMTILNTWEANLCAVKEAL.[10].KDLEHIFGCTTNQTMENFGVK      DKRAFIQEWYDGVVR.[4].ISF 77
gi 81610437    11 VAFDVDGTLLDTEKAVLVSLQKVL.[10].EELRFVLGIPGVTALEQLGVP      DPGAAFDKWVAYARE.[4].VTV 87
gi 81507486     5 IIFDVDGTILDTERAVLHSLQAVL.[ 9].DELRFVLGITGAAAVEQLNIL      DQEKVLGKWIEREAT.[4].VEV 80
42_pfamImport   1 ILFDLDGTLVNSSPGIKAAFNYAF.[10].KQLSTFIGPPLEVTFGHYFEQ.[ 6].AIKTFRDYYGEKGVH.[1].VSL 80
43_pfamImport   1 ILFDLDGTLVNSSPGIKAAFNYAF.[10].KQLSTFIGPPLEVTFGNYFDQ.[ 6].AIKTFRDYYGTKGIH.[1].VSL 80
7_pfamImport    1 IIFDLDDTLYNERDFVIGGFKEIC      KYLSEKYGLEYDELLYKVIEI.[21].NIEILVDIYRNSKLK     LNL 84

gi 122265225   83 YDGIDEMFAGL.[1].E.[5].GIVTSKLRRVFDDEMRSFPKIRAIEKVVLSDDTKKH     K.[2].ADPIEFGMQKY 150
38_pfamImport  82 IPGIGELLREL.[2].R.[5].GCVTGRTKESLDITGNRLNFLRFFEDIEVGSPKGVN     K     AETIKVLMRKF 148
10_pfamImport  90 FPHLVWMLEEL.[1].R.[5].GIITNGKGQFQMHSIKVLGIEGYFDTILISEWEGIS     K.[2].PRLFQKAMDHL 157
21_pfamImport  77 YPEVLNMLEQL.[1].K.[5].GIVTSNTPAEFAAHHDRFGIEQFFTDFVFAGMTKNM     K.[2].ADPILLAMNNL 144
13_pfamImport  78 FEGMKELLYEL.[1].E.[5].GIVTSRTNAEAQVDVERFQMDGIFNQIIGADDVLMP     K.[2].PDPLNKFIEEN 145
gi 81610437    88 FPGIVELLDEL.[1].D.[5].GLVTSRTRIELDGDLVHFGLLERFRAVVCADDTEGH     K.[2].PDPLLKLMADT 155
gi 81507486    81 FEGIHKVLHAI.[2].S     GVVTSKNALEMEKGFYPFNIQDHFQAIVCASDTENH     K.[2].PDPLLKGLEIL 144
42_pfamImport  81 YTGIAEALQEL.[1].D.[5].FVTTSKHQPMANLMLTELGIISHFKKVYGSTPEYFH     K     ADVIKACLTEQ 146
43_pfamImport  81 YEGISDVLEEL.[1].H.[5].FVTTSKHQPMARQMLTDLGIISYFEKVYGSTPQHFH     K     ADVIKACLTEQ 146
7_pfamImport   85 YDDSRYILNKL     K.[5].GIITDGMAKVQWNKIEALNIKSYFNKIIVTDDFGRE.[2].K.[2].IFSYEEMLRSF 153

gi 122265225  151 .[2].KLNRADVIYVGDSL     FDMQSAHAAGVDFANA 182
38_pfamImport 149      GVDRAEVIYVGDSA     SDIKAMKAAGVDIISV 178
10_pfamImport 158      NVLPNESVFVGDHP.[1].NDIQAARNIGMKTIWK 188
21_pfamImport 145      VSDPSQTIYIGDSI     HDMQAAHNAGIAYGMA 174
13_pfamImport 146      KTQKEKVIYVGDAI     SDLKCALRAGVDFAAA 175
gi 81610437   156      GFSPGEVLYIGDTV     YDSQCARAAGVKFALA 185
gi 81507486   145      GREPHEVLYVGDSS     YDMKCAHAAGAHFGLA 174
42_pfamImport 147      GIQAHEAVIIGDTK     FDMIGGQKTGVRRLGV 176
43_pfamImport 147      KIQAHEAVIVGDTK     FDMIGGKKTGVRRLGV 176
7_pfamImport  154      KCLPEEVIYVGDNP.[1].KDFIGARELGIKTLRI 184
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap