Conserved Protein Domain Family
Med3

?
pfam11593: Med3 
Mediator complex subunit 3 fungal
Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function. Mediator subunit Hrs1/Med3 is a physical target for Cyc8-Tup1, a yeast transcriptional co-repressor.
Statistics
?
PSSM-Id: 314474
View PSSM: pfam11593
Aligned: 4 rows
Threshold Bit Score: 290.497
Threshold Setting Gi: 74610965
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

gi 74610965   13 DVLTPSMSLTELEMKFADETD.[ 1].KAKDVVQARIKKAEDGILPLRLQFNDFTQIMSSLDE.[2].YANVSKQEKFQM 84
gi 78099785    3 SIIPAGVKLDDLQVILAKNEN      ETRDKVCKQINEARDEILPLRLQFNEFIQIMANIDQ.[2].SKQADRMAKYLH 73
gi 365986186  11 KLLTPKLTLDQLEDRLAGDID.[11].LPKQVIANSLIETEKSILPLRLVFNKLIQTMATLDT     MPEKSQQEMFLS 90
gi 401625743   3 SIIPADTKLEDLEVKLAKNEN      ETRDNVCKQINEARNEILPLRLQFNEFIQSMANIDH.[2].TKQGDRMVKYLH 73

gi 74610965   85 IRSKVLGLTERLQELSNDFEELQPLFATVGEYSK.[2].KNKN     FQVLENL     ASYNHRGKA     GASISN 146
gi 78099785   74 IRDKILQLNDRFQTLSSHLEALQPLFSTVPEYLK.[2].DNRD.[2].FQLLEPL     STYNKNGNA.[3].TATVVS 140
gi 365986186  91 IRNQLLDLYTKIQEISTDFQHLQPLFGTIEEYSE     KNNT.[2].FHMLETL.[9].TAKATKGDA.[3].KKKSVA 164
gi 401625743  74 IRDSILQLNDRFQSLSSHLETLQPLFNTVPEYLR.[2].DNKD.[2].FQLLEPL     STYNQNGTV.[3].AAAVAN 140

gi 74610965  147 STPTPAAATPTT.[2].TPGAGTKKAAKTAPTPT     ATA.[ 6].NNAPTPATTA.[6].AKKPRKPRQTKK.[5]. 219
gi 78099785  141 TNHSAAASTPTT.[2].TPHANPITHAHSLSNPN     STA.[25].NSTAAAPIAA     PKKPRKPRQTKK      221
gi 365986186 165 GTPGSVGNTPVG.[1].TPGSSTGTVAANVPANI     NAN.[ 3].TSTTSAASTT.[6].AKKPRKPRQNKK      228
gi 401625743 141 TSHSTAASTPTT     TPHANSNAHTHSLSNPN.[1].TTA.[22].NSAAAAATAA     AKKPRKPRQTKK.[2]. 219

gi 74610965  220 AAAAAVAQAQAQAQAQAQNQ.[30].QMQS.[3].A.[12].AMRPSVP.[5].NPSM.[1].NLNMNAPN     MGNP 318
gi 78099785  222 AKAQAQAQAQAQAQVYAQQS      TVQT.[3].A      SMAAALP     NPTP.[1].MINSVSPT.[2].MGTP 275
gi 365986186 229 AAAKAQQQQQQQLLQQQQQQ      QIPK     Q.[ 7].MMNMNAM     NATP     MMNSVSPS.[2].MGTP 285
gi 401625743 220 AQAQAQAQAQAQAQAQAQAQ.[ 6].AVQT.[3].A      SMTAALP     NPTP.[1].IINSVSPT.[2].MGTP 279

gi 74610965  319 NMN.[9].MMSPMA.[6].QMFPMQNHNQNGQFMGQQ     SPGPN.[6].PPN.[8].GTSD.[14].MNLNQITPAN 410
gi 78099785  276 LTN     MMSPMG     NAYSMGAQNQGGQVSMSQ.[4].GNGSN     PNT.[8].LQSQ      LNLNNLTPAN 336
gi 365986186 286 LNN     GISPMG.[5].GFYSQPPGSQSQQFDQQM     NNGDH     NTN     NNNF      QNMNNITPAN 339
gi 401625743 280 LTN     MMSPMT     NAYSMVAPNQGGQPAMSQ.[4].SNGTN     PNP.[8].LQSQ      LNLNNLTPAN 340

gi 74610965  411 ILSMN.[14].QNQNQNQSQNQSQNQ.[1].QS.[4].MNNDSNNPKS.[1].Y.[10].SSLNMDFL 481
gi 78099785  337 ILNMS.[ 6].QQQQQQQQQQQPQPQ     YN.[4].MNNMNNGGKE     L.[10].GGLNMDFL 397
gi 365986186 340 ILSMN.[ 5].QSRMASSSQQYPTNN     NN     NNTLDLNNLD     L      SSLNMDFL 385
gi 401625743 341 ILNMS.[ 6].QQQQQQQQPQQPQQQ.[1].YN     MNTMNNNGKE     L.[10].GGLNMDFL 398
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap