6VJA


Conserved Protein Domain Family
CD20

?
pfam04103: CD20 
CD20-like family
This family includes the CD20 protein and the beta subunit of the high affinity receptor for IgE Fc. The high affinity receptor for IgE is a tetrameric structure consisting of a single IgE-binding alpha subunit, a single beta subunit, and two disulfide-linked gamma subunits. The alpha subunit of Fc epsilon RI and most Fc receptors are homologous members of the Ig superfamily. By contrast, the beta and gamma subunits from Fc epsilon RI are not homologous to the Ig superfamily. Both molecules have four putative transmembrane segments and a probably topology where both amino- and carboxy termini protrude into the cytoplasm. This family also includes LR8 like proteins from humans, mice and rats. The function of the human LR8 protein is unknown although it is known to be strongly expressed in the lung fibroblasts. This family also includes sarcospan is a transmembrane component of dystrophin-associated glycoprotein. Loss of the sarcoglycan complex and sarcospan alone is sufficient to cause muscular dystrophy. The role of the sarcoglycan complex and sarcospan is thought to be to strengthen the dystrophin axis connecting the basement membrane with the cytoskeleton.
Statistics
?
PSSM-Id: 397979
View PSSM: pfam04103
Aligned: 41 rows
Threshold Bit Score: 48.4049
Threshold Setting Gi: 75045739
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

6VJA_C        14 .[1].LGAV     QIMNGLFHIALGGLLMIPAGI.[4].CVTVWYPLWGGIMYIISGSLL     AATEKNSR     K 73 
Q3TRE0        28 .[1].LALL     QLALGIAVTVLGFLMASISPS     LLVRDTPFWAGIIVCVVAYLG     LFMLCVSY.[2].D 85  house mouse
Q1LVQ8        42 .[1].VALL     QLLLGIAVAAVAFLMLAISSS     LLARETPHWAGIIMCVVSLLG     FVLFCITR.[4].R 101 zebrafish
Q5HZJ5        36 .[1].LGLA     QVLLGILVITFSMVASSVTTT.[1].SIKRSCPSWAGFSLAFSGLVG     IVSWKRPF     T 92  house mouse
Q0V9M1        36 .[1].LGVS     QMVLGCLIVAVSFAALALTTS.[1].RVRHSCPFWAGFSVLLSGLIG     VVAWKRPL     S 92  tropical clawed frog
Q95PZ5        94 .[1].LCLV     ELMLAVVILGGGIWCYRDTSD     YCPYYSAIWTSAIYIINAIVG     SAAAKMGA     L 149 Caenorhabditis elegans
EDO34181       7 .[1].LGII.[3].HLVFGVFSVVLGIVTFKVAPY.[1].YGVFGMGIWLGAWMLITGVAG.[1].LTASVPTN     M 67  starlet sea anemone
NP_001037935   3 .[1].LGIL     QIACAGISIVSGFMDGAFRRE.[2].LGRTRAPLWAGLIMTIPGVLA     LFSSQKKN     P 60  tropical clawed frog
XP_002935642  85 .[1].LGLL     QLILGCCTVALSFGALSLSKS.[1].QIRSSCPFWAGSSVILSGIVG     LTTWKRPM     V 141 tropical clawed frog
CAG03430      34 .[1].VALL     QLLLGVAVTVVAFLMLAISPS     LLARETPHWAGIILCLVSVLG     FILYCITY.[2].D 91  spotted green puffer...

6VJA_C        74 .[2].VKGKMIMNSLSLFAAISGMILSIMDILNIKISHFL.[25].SEKNSPSTQYCYSI.[3].FLGILSVMLIFAFFQ 167
Q3TRE0        86 .[2].TCVQFSMKVFYFLLSALGLMVCMLAVAFAAHHYSL.[17].PSSEPLSRAFVYRD.[3].CTSVTGTFKLFLIIQ 171 house mouse
Q1LVQ8       102      ALLQFVIKLLYFFLCTMGLVMSVVVIAFQCYHYTL.[17].DPEDPIARMFVFSA.[3].CSDITSTLPMYYLLQ 185 zebrafish
Q5HZJ5        93 .[2].ISFFSLLSVLCVMLSMAGSVLSCKNAQLARDFREC.[23].QELKVALNSTCDEA.[3].LKNLLFSVCGLTICA 184 house mouse
Q0V9M1        93 .[2].ITFFMLLSAVCVMLNLAGSILSCQNAQLVSSLEGC.[27].ETLKLNPLQECSAV.[3].LKDLLFSVCALNIIS 188 tropical clawed frog
Q95PZ5       150 .[2].YMAHLTLSLVSVMMCLISGGLSARNWALVGTYHHP.[23].SHMDKYDFAKCLWQ.[3].GVAVNSVQFVIAAIE 241 Caenorhabditis elegans
EDO34181      68 .[2].LGSFIGCSLVGLVTLFVCAIIIGLGVLQHFKFESS.[16].YSRPQEHFDERNQN.[3].GVGIYGTLLALIVMD 152 starlet sea anemone
NP_001037935  61 .[2].VNALIAASVFSCFTTLIVIVYASLTLGYGEDDDDI.[ 3].PPHVIHARFILGKL     VQGANIAMLIASVSS 129 tropical clawed frog
XP_002935642 142 .[2].VNLFVMLSVVCVLLNLAGFILGCQGAQFVSSVPSC.[26].NFLKLFPVQSCNAV.[3].LKKVFFALCALNALT 236 tropical clawed frog
CAG03430      92 .[2].TSAQFICEVLYFILCSIGLVLSVLVVAFAGHHYSQ.[17].SQEDPIARTFTYEG.[3].CQAITGTLTLYFLVQ 177 spotted green puffer...

6VJA_C       168 ELVIAGIVENE.[1]. 179
Q3TRE0       172 MVLNLVCGLVC.[1]. 183 house mouse
Q1LVQ8       186 VLLNLAQAIVC.[1]. 197 zebrafish
Q5HZJ5       185 AIICTLSAIVC.[1]. 196 house mouse
Q0V9M1       189 TIVCALATAMC.[1]. 200 tropical clawed frog
Q95PZ5       242 VFLNILSAILC.[1]. 253 Caenorhabditis elegans
EDO34181     153 VIVNLVTMAVC.[1]. 164 starlet sea anemone
NP_001037935 130 LCVALCIAYMG.[1]. 141 tropical clawed frog
XP_002935642 237 TTVCLVAAALR.[1]. 248 tropical clawed frog
CAG03430     178 IVLNLAQALVC.[1]. 189 spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap