2FP4


Conserved Protein Domain Family
Ligase_CoA

?
pfam00549: Ligase_CoA 
Click on image for an interactive view with Cn3D
CoA-ligase
This family includes the CoA ligases Succinyl-CoA synthetase alpha and beta chains, malate CoA ligase and ATP-citrate lyase. Some members of the family utilize ATP others use GTP.
Statistics
?
PSSM-Id: 334139
View PSSM: pfam00549
Aligned: 21 rows
Threshold Bit Score: 107.73
Threshold Setting Gi: 157085669
Created: 14-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

2FP4_B   269 FVNGAGLAMATCDIIFLNGGKPANFLDLGGGVK     ESQVYQAFKLLTADP     KVEAILVNIFGG.[1].VNCAI 334 pig
P53588   292 MVNGAGLAMATMDIIKLHGGEPANFLDVGGGAT     VEQVTEAFKIITADK.[1].KVSAILVNIFGG.[1].MRCDV 358 Caenorhabditis elegans
P53590   307 FVNGAGLAMATCDIIFLNGGKPANFLDLGGGVK     ESQVYQAFKLLTADP     KVEAILVNIFGG.[1].VNCAI 372 pig
P53589   290 LVNGAGLAMATMDLIKLHGGEPANFLDVGGAVT     EDAVFNAVRIITSDP     RVKCVLINIFGG.[1].VNCAT 355 Caenorhabditis elegans
Q03184   279 LVNGAGLAMATMDVIKLAGGDPANFLDLGGAAS     EAAVTEGFTIISQQS     HVKAILVNIFGG.[1].VRCDM 344 Trichomonas vaginalis
P53592   263 MVNGAGLAMATMDLIKLSGGDPANFLDVGGSAT     KERVTEAFKIIVSDK     NVKGILVNIFGG.[1].VRCDL 328 Coxiella burnetii RSA 493
P53399   163 VSRSGTLTYEAAYATTLAGLGQSTVVGIGGDPF.[1].GQLHTDVVKRFAADP     QTEGIILIGEIG     GTSEE 228 Trichomonas vaginalis
P53596   177 VSRSGTLTYEAVHQTTQVGFGQTLCVGIGGDPF.[1].GTNFIDCLNVFLEDP     ETKGIILIGEIG     GSAEE 242 Caenorhabditis elegans
P53598   181 ISRSGTLTYEAVQQTTKTDLGQSLVIGMGGDAF.[1].GTDFIDALKLFLEDE     TTEGIIMLGEIG     GKAEI 246 Saccharomyces cerevisiae...
EDZ71911 152 LVNGAGLAMATMDVIKLNGGDPANFLDCGGGAT     PETIKQGFELILSNK     NVDAIFVNIFGG.[1].VRCDY 217 Saccharomyces cerevisiae...

2FP4_B   335 IANGITKACREL.[1].LKVPLVVRLEGTNV.[1].EAQNILTNSGLPITSAVDLEDAAKKAV 389 pig
P53588   359 IAQGIIQAAREL.[1].LKIPIVVRLQGTKV.[1].DAKALIATSQLRILPCDNLDEAAKMVV 413 Caenorhabditis elegans
P53590   373 IANGITKACREL.[1].LKVPLVVRLEGTNV.[1].EAQNILTNSGLPITSAVDLEDAAKKAV 427 pig
P53589   356 IANGVVSAVNKI.[1].LNVPMVVRLEGTNV.[1].AAKQIMKKSGLKILTANNLDEAAAKAV 410 Caenorhabditis elegans
Q03184   345 VAAGVIAAFKKV.[1].LKVPLVVRLEGTNV.[1].AGKKLIRESGLPIISADNLTDAGEKAV 399 Trichomonas vaginalis
P53592   329 IADGIISAVKEV.[1].IDVPVVVRLEGNNA.[1].LGAKKLADSGMNIIAAKGFADAAEQIV 383 Coxiella burnetii RSA 493
P53399   229 DAAEWIAKTKLT     QEKPVVASIAGATA.[6].GHAGAIVSGGKGTAEGKYKALEAAGVR 287 Trichomonas vaginalis
P53596   243 EAAAYLKEHNSG.[1].NRKPVVSFIAGVTA.[6].GHAGAIISGGKGTAADKINALREAGVV 302 Caenorhabditis elegans
P53598   247 EAAQFLKEYNFS.[2].KPMPVASFIAGTVA.[8].GHSGAIVEGSGTDAESKKQALRDVGVA 309 Saccharomyces cerevisiae S288c
EDZ71911 218 VALGLVEAAREL.[1].VRVPIVARLQGTKV.[1].EGRDIINKSGVKIYSFDELDPAAKKVV 272 Saccharomyces cerevisiae AWRI1631
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap