6E1K,3J9P,6CUD,6PUR,6O20,5H3O,6E1K,5XSY,6AGF,5XSY,5XSY,3JBR,5XSY


Conserved Protein Domain Family
Ion_trans

?
pfam00520: Ion_trans 
Click on image for an interactive view with Cn3D
Ion transport protein
This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.
Statistics
?
PSSM-Id: 395416
View PSSM: pfam00520
Aligned: 243 rows
Threshold Bit Score: 55.736
Threshold Setting Gi: 38503232
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

6E1K_A        93 DRDYYYLGELPYLTNAESIIY      EVITLAILLVHTFFPISYEGS     RIFWTSRLNLVKVACVVILFVDV 157 thale cress
O73606       216 GKIFACISISFVAITAVSLCI.[25].ETVCVAWFSFEFLLRSIQAEN.[1].CAFLKTPLNIIDILAILPFYISL 306 chicken
XP_012367187 226 GKVFACLSVLFVTVTAVNLSV.[25].ESVCVGWFSLEFLLRLIQAPS.[1].FAFLRSPLTLIDLVAILPYYITL 316 northern white-cheeked g...
P97557       212 ARIFGVISIIFVAVSIVNMAL.[16].EYVCISWFTGEFILRFLCVKD.[1].CHFLRKVPNIIDLLAILPFYITL 293 Norway rat
Q9BQ31       184 AKLIAISSLSVVLASIVAMCV.[21].EIACIAWFTGELAVRLAAAPC.[1].KKFWKNPLNIIDFVSIIPFYATL 270 human
O35173       188 SKLFSCVSIGVVLASIAAMCI.[36].EYFCIAWFSFEVSSRLLLAPS.[1].RNFFCHPLNLIDIVSVLPFYLTL 289 house mouse
O35174       186 SRVFSVLSILVVLGSIITMCL.[24].EHFGIAWFTFELVARFAVAPD.[1].LKFFKNALNLIDLMSIVPFYITL 275 house mouse
Q26094       173 AKIFAILSVVIIVVSLIMFVI.[33].NTAVICWFTIEFILRLICCPN.[1].IKFFLNTGNIIDFLSILPYYLSL 271 penicillate jellyfish
O76457       173 AKIIAVISVFFIVISILSFCL.[41].ECASNAWFTFEIIIRFVVAPN.[1].LDFLKAPVNIIDIVATLSFYLDF 279 California sea hare
P17972       173 AKTIGVVSVFFICISILSFCL.[41].ECVCNAWFTFEILVRFISSPN.[1].WEFIKSSVNIIDYIATLSFYIDL 279 fruit fly

6E1K_A       158 .[ 6].LS.[ 2].AFDFLPFRIAPYVRVIIFILSIRELRDTLVLLSGMLGTYLNILALWMLFLLFASWIA.[13].FTS 240 thale cress
O73606       307       IV.[23].GLVLRFLRALRILYVMRLARHSLGLQTLGLTVRRCTREFGLLLLFLCVAMALFSPLV.[12].FTS 403 chicken
XP_012367187 317       LV.[20].GLVLRVLRALRILYVMRLARHSLGLQTLGLTARRCTREFGLLLLFLCVAIALFAPLL.[12].FTS 410 northern white-cheek...
P97557       294 .[15].NV      GRLVQVLRLLRALRMLKLGRHSTGLRSLGMTITQCYEEVGLLLLFLSVGISIFSTIE.[11].FTS 381 Norway rat
Q9BQ31       271       AV.[13].GKVVQILRLMRIFRILKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLI.[11].LTS 356 human
O35173       290       LA.[18].GKVVQVFRLMRIFRVLKLARHSTGLRSLGATLKHSYREVGILLLYLAVGVSVFSGVA.[ 9].FHT 378 house mouse
O35174       276       VV.[13].GRVAQVLRLMRIFRILKLARHSTGLRSLGATLKYSYKEVGLLLLYLSVGISIFSVVA.[10].LAT 360 house mouse
Q26094       272 .[ 4].SS      KGSFSMLRVIRVLRVFKLSRHSRGLQILGNTLKASFNELMMLAFFLFVMILIFGSCV.[11].FIS 348 penicillate jellyfish
O76457       280 .[ 6].QE      SDMLEFFSIIRIMRLCKLTRHSAGLKILIHTFKASAKELILLIFFLVLGIVIFAALI.[13].FES 360 California sea hare
P17972       280       VL.[ 9].ADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLV.[13].FNS 363 fruit fly

6E1K_A       241 YGATLYQMFILFTTSNNPDVWIPAYKSS.[5].FFVLYVLIGVYFVTNLILAVVYDSFKEQLAKQV 306 thale cress
O73606       404 IPTSYWWAVISMTTVGYGDMVPRSIPGQ     VVALSSILSGILLMAFPVTSIFHTFSRSYSELK 464 chicken
XP_012367187 411 IPACYWWAVITMTTVGYGDMVPRSTPGQ     VVALSSILSGILLMAFPVTSIFHTFSRSYLELK 471 northern white-cheeked gibbon
P97557       382 VPCAWWWATTSMTTVGYGDIRPDTTTGK     IVAFMCILSGILVLALPIAIINDRFSACYFTLK 442 Norway rat
Q9BQ31       357 IPICWWWATISMTTVGYGDTHPVTLAGK     LIASTCIICGILVVALPITIIFNKFSKYYQKQK 417 human
O35173       379 IPACWWWGTVSMTTVGYGDVVPETVGGK     LAASGCILGGILVVALPITIIFNKFSHFYRRQK 439 house mouse
O35174       361 IPACWWWATVSMTTVGYGDVVPGTTAGK     LTASACILAGILVVVLPITLIFNKFSHFYRRQK 421 house mouse
Q26094       349 IPSSFWWAIVTMTTVGYGDMHPVTFWGQ     IVGSMAVVCGVLTIALPVPVVVSNFEYFYTKER 409 penicillate jellyfish
O76457       361 IPVGLWWAIVTMTTVGYGDMAPKTYVGM     FVGALCALAGVLCIALPVPVIVSNFALFYSHTQ 421 California sea hare
P17972       364 IPLGLWWALVTMTTVGYGDMAPKTYIGM     FVGALCALAGVLTIALPVPVIVSNFAMYYSHTQ 424 fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap