4E1O,3K40,1XEY


Conserved Protein Domain Family
Pyridoxal_deC

?
pfam00282: Pyridoxal_deC 
Click on image for an interactive view with Cn3D
Pyridoxal-dependent decarboxylase conserved domain
Statistics
?
PSSM-Id: 395219
View PSSM: pfam00282
Aligned: 9 rows
Threshold Bit Score: 412.582
Threshold Setting Gi: 55670836
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

4E1O_E        40 PGYLRA.[1].LPESAPEDPD.[1].WDSIFGDIERIIMPGVVHWQ.[1].PHMHAYYP.[14].DAINCLGFTWASSPA 115 human
P34751       377 PGYLKA.[1].LPPKAPQKAE.[1].IDDILEDYHKLIVPGLSHSS.[1].PNFHSFYP.[14].GHIGDAGFYWTSNPA 452 Caenorhabditis elegans
P27718        35 PGYLRP.[1].IPTTAPQEPE.[1].FEAIIEDIEKIIMPGVTHWH.[1].PYFFAYFP.[14].GAIGCIGFSWAASPA 110 cattle
Q05733        35 PGYMRQ.[1].LPESAPIEGE.[1].WPKIFSDVERIVMPGITHWQ.[1].PHMHAYFP.[14].DAINCLGFTWASSPA 110 fruit fly
3K40_B        35 PGYLKP.[1].IPDAAPEKPE.[1].WQDVMQDIERVIMPGVTHWH.[1].PKFHAYFP.[14].GAIACIGFTWIASPA 110 fruit fly
1XEY_A        33 PLHEMR     DDVAFQIIND     ELYLDGNARQNLATFCQTWD.[1].ENVHKLMD      LSINKNWIDKEEYPQ 92  Escherichia coli
NP_001233822  33 PENSIP     KEAAYQIIND     ELMLDGNPRLNLASFVTTWM.[1].PECDKLMM      DSINKNYVDMDEYPV 92  tomato
P14748       144 PHQLLE.[4].FNLELSDHPE.[1].LEQILVDCRDTLKYGVRTGH     PRFFNQLS.[14].STANTNMFTYEIAPV 221 domestic cat
P20228        64 PEDMKR.[1].LDLDVPDRAL.[1].LQQLIEDCATTLKYQVKTGH     PHFFNQLS.[14].ATANTNMFTYEIAPV 138 fruit fly

4E1O_E       116 CTELEMNVMDWLAKMLGLP.[4].H.[6].GGGVLQSTVSESTLIALLAARKNKILEMKTSE.[10].RLVAYASD 195 human
P34751       453 LTELEVLMMDWLGEMMALP.[4].L.[6].GGGCMQRSDTESNFLVLVAARTDMIRRMKQRD.[10].RLVAYTSS 532 Caenorhabditis elegans
P27718       111 CTELETVMMDWLGKMLQLP.[4].A.[5].GGGVIQGTASEATLVALLAARTKVTRHLQAAS.[10].KLVAYASD 189 cattle
Q05733       111 CTELEIIVMNWLGKMIGLP.[4].H.[6].GGGVLQTTASEATLVCLLAGRTRAIQRFHERH.[10].RLVAYCSD 190 fruit fly
3K40_B       111 CTELEVVMMDWLGKMLELP.[4].A.[5].GGGVIQGTASESTLVALLGAKAKKLKEVKELH.[10].KLVGYCSD 189 fruit fly
1XEY_A        93 SAAIDLRCVNMVADLWHAP.[4].G.[1].AVGTNTIGSSEACMLGGMAMKWRWRKRMEAAG.[ 4].KPNLVCGP 161 Escherichia coli
NP_001233822  93 TTELQNRCVNMIAHLFNAP.[4].E.[1].AVGVGTVGSSEAIMLAGLAFKRKWQNKMKAQG.[ 4].KPNIVTGA 161 tomato
P14748       222 FVLMEQITLKKMREIVGWS     S.[2].GDGIFSPGGAISNMYSIMAARYKFFPEVKTKG.[ 5].KLVLFTSE 288 domestic cat
P20228       139 FILMENVVLTKMREIIGWS     G     GDSILAPGGSISNLYAFLAARHKMFPNYKEHG.[ 6].TLVMFTSD 204 fruit fly

4E1O_E       196 .[1].AHSSV     EKAGLISLVK     MKFLPVD.[2].F.[1].LRGEALQKAIEEDKQR.[2].VP.[1].FVCA 247 human
P34751       533 .[1].ARRSI.[2].KMAAEVAMVK     MRVLPTD.[2].F.[1].LRGDTLHAAIMADIER.[2].IP.[1].FVGA 586 Caenorhabditis elegans
P27718       190 .[1].AHSSV     EKAGLIGGVR     LKAIPSD.[2].F.[1].MRASALQEALERDKAA.[2].IP.[1].FVVA 241 cattle
Q05733       191 .[1].AHSSV     EKAALIGLVR     MRYIEAD.[2].L.[1].MRGKLLREAIEDDIKQ.[2].VP.[1].WVCA 242 fruit fly
3K40_B       190 .[1].AHSSV     ERAGLLGGVK     LRSVQSE.[1].H.[1].MRGAALEKAIEQDVAE.[2].IP.[1].YAVV 240 fruit fly
1XEY_A       162      VQICW     HKFARYWDVE     LREIPMR.[1].G     QLFMDPKRMIEACDEN     TI     GVVP 207 Escherichia coli
NP_001233822 162 .[1].VQVCW     EKFARYFEVE     LKEVKLT.[1].G     YYVMSPEKAVEMVDEN     TI     CVAA 208 tomato
P14748       289 .[1].SHYSI     KKAGAALGFG.[3].VILIKCN.[2].G.[1].IIPADLEAKILEAKQK.[2].VP.[1].YVNA 343 domestic cat
P20228       205 .[1].CHYSI     KSCAAVCGLG.[3].CIVVPSD.[2].G.[1].MITSELERLILERKAK.[2].IP.[1].FVNA 259 fruit fly

4E1O_E       248 TLGTTGVCAFDXLSELGPICAR     EGLWLHIDAAYAG.[2].FLCPEFRG     FLKGIEYADSFTFNPSKWMMVH 314 human
P34751       587 NFGTSGPCSFDHLHELGPVCRE     HGTWLHVDAAYAG.[2].LICPEIRG     LMRGIDWADSFCTTPSKLIIAV 653 Caenorhabditis elegans
P27718       242 TLGTTSCCSFDNLLEVGPICHE     EGLWLHVDAAYAG.[2].FICPEFRH     LLNGVEFADSFNFNPHKWLLVN 308 cattle
Q05733       243 TLGTTGSCSFDNLEEIGIVCAE     HHLWLHVDAAYAG.[2].FICPEFRT     WLRGIERADSIAFNPSKWLMVH 309 fruit fly
3K40_B       241 TLGTTNSCAFDYLDECGPVGNK     HNLWIHVDAAYAG.[2].FICPEYRH     LMKGIESADSFNFNPHXWMLVN 307 fruit fly
1XEY_A       208 TFGVTYTGNYEFPQPLHDALDK.[6].IDIDMHIDAASGG     FLAPFVAP.[3].WDFRLPRVKSISASGHKFGLAP 281 Escherichia coli
NP_001233822 209 ILGSTLNGEFEDVKKLNDLLIE.[6].WDTPIHVDAASGG     FIAPFIYP.[3].WDFRLPLVKSINVSGHKYGLVY 282 tomato
P14748       344 TAGTTVYGAFDPIQEIADICEK     YNLWLHVDAAWGG.[2].LMSRKHRH     KLSGIERANSVTWNPHKMMGVL 410 domestic cat
P20228       260 TAGTTVLGAFDDINTIADICQK     YNCWMHIDAAWGG.[2].LMSRKHRH.[1].RFTGVERADSVTWNPHKLMGAL 327 fruit fly

4E1O_E       315 FDCTGFWVKDKYKLQQTF.[6].LR.[7].TDFMHWQIPLSR     RFRSVKLWFVIR.[1].FGVKNLQAHVRHGTEM 388 human
P34751       654 CDVCCLWVRDRHKLQHAS     LE.[2].PDLPFKGLPTSQ     RVGALKIWFMIR.[1].FGVENLQNQIREHIRL 716 Caenorhabditis elegans
P27718       309 FDCSAMWVKKRTDLTGAF.[6].LR.[9].TDYRHWQLPLGR     RFRSLKMWFVFR.[1].YGVKGLQAYIRKHVQL 384 cattle
Q05733       310 FDATALWVRDSTAVHRTF.[6].LQ.[7].VDFMHWQIPLSR     RFRALKVWFVLR.[1].YGIKGLQRHIREGVRL 383 fruit fly
3K40_B       308 FDCSAMWLKDPSWVVNAF.[6].LK.[7].PDYRHWQIPLGR     RFRALKLWFVLR.[1].YGVENLQAHIRRHCNF 381 fruit fly
1XEY_A       282 LGCGWVIWRDEEALPQEL.[6].LG     GQIGTFAINFSR.[2].GQVIAQYYEFLR     LGREGYTKVQNASYQV 349 Escherichia coli
NP_001233822 283 AGIGWVIWRNKEDLPDEL.[6].LG     ADQPTFTLNFSK.[2].SQVIAQYYQLIR     LGYEGYKNVMENCQEN 350 tomato
P14748       411 LQCSAILVKEKGILQGCN.[6].LF.[9].YDTGDKAIQCGR     HVDIFKFWLMWK.[1].KGTVGFENQINKCLEL 486 domestic cat
P20228       328 LQCSTIHFKEDGLLISCN.[6].LF.[9].YDTGDKVIQCGR     HNDIFKLWLQWR.[1].KGTEGFEQQQDRLMEL 403 fruit fly

4E1O_E       389 AKYFESLVRNDPS     FEIPA     KRHLGLVVFRLK 418 human
P34751       717 GQVMTKILQKDLR     FEVCN     KVVMGLICFRAK 746 Caenorhabditis elegans
P27718       385 SHAFEALVRQDTR     FEICA     EVILGLVCFRLK 414 cattle
Q05733       384 AQKFEALVLADHR     FELPA     KRHLGLVVFRIR 413 fruit fly
3K40_B       382 AKQFGDLCVADSR     FELAA     EINMGLVCFRLK 411 fruit fly
1XEY_A       350 AAYLADEIAKLGP.[1].EFICT.[3].DEGIPAVCFKLK 383 Escherichia coli
NP_001233822 351 ARVLREGLEKTGR     FEIVS.[1].EVGVPLVAFSLK 381 tomato
P14748       487 AEYLYAKIKNREE     FEMVF.[2].EPEHTNVCFWYI 518 domestic cat
P20228       404 VQYQLKRIREQSD.[1].FHLIL     EPECVNVSFWYV 434 fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap