1PUF,1HDP,3L1P,2DA2,2MGQ,2E1O,5ZJQ,1ZQ3


Conserved Protein Domain Family
Homeobox

?
pfam00046: Homeobox 
Click on image for an interactive view with Cn3D
Homeobox domain
Statistics
?
PSSM-Id: 395001
View PSSM: pfam00046
Aligned: 149 rows
Threshold Bit Score: 57.8909
Threshold Setting Gi: 61217396
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

1PUF_B         4 KRRNFNKQATEILNEYFY.[3].SNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK.[1]. 61  human
B3DM23       304 MRTCFDSVLKGRLEGHFM     CNQKPGARELAEIAKELGLEKDVVRVWFCNRRQKEK.[1]. 358 tropical clawed frog
P20268       284 KRTSIEVNVKSRLEFHFQ     SNQKPNAQEITQVAMELQLEKEVVRVWFCNRRQKEK.[1]. 338 Caenorhabditis elegans
B3DM25       329 RRTNIENIVKGTLESYFM     KCSKPGAQEMVQIAKELNMDKDVVRVWFCNRRQKGK.[1]. 383 tropical clawed frog
3L1P_B        99 KRTSIENRVRWSLETMFL     KSPKPSLQQITHIANQLGLEKDVVRVWFSNRRQKGK.[1]. 153 house mouse
Q90270       346 RRTSLEGTVRSALESYFV     KCPKPNTLEITHISDDLGLERDVVRVWFCNRRQKGK.[1]. 400 zebrafish
Q03052       342 KRTSIEVGVKGALESHFL     KCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEK.[1]. 396 human
Q9YGL7       288 RRTTISISAKEALERHFG     EQSKPSSQEIMRMAEGLNLEKEVVRVWFCNRRQREK.[1]. 342 chicken
Q91998       280 KRTSIAAPEKRSLEAYFA     VQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQK.[1]. 334 chicken
NP_001272403 319 HRTSIENNVKRTLETYFM     QCPKPSAQEIAQIARELNMEKDVVRVWFCNRRQKGK.[1]. 373 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap