Conserved Protein Domain Family
BTB_POZ_BTBD11

?
cd18351: BTB_POZ_BTBD11 
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in BTB/POZ domain-containing protein 11 (BTBD11)
BTBD11, also called ankyrin repeat and BTB/POZ domain-containing protein BTBD11, is a BTB-domain-containing protein. The BTBD11 gene has been recently identified as an all-trans retinoic acid (atRA)-responsive gene that lies downstream of atRA and its receptors in the regulation of neurite outgrowth and cell adhesion in neural as well as non-neural tissues. The BTB/POZ domain is a common protein-protein interaction motif of about 100 amino acids.
Statistics
?
PSSM-Id: 349660
View PSSM: cd18351
Aligned: 5 rows
Threshold Bit Score: 288.03
Threshold Setting Gi: 512829085
Created: 19-Sep-2017
Updated: 11-Jul-2018
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

gi 269849706   899 PKLTEIKRKQTSRLDPHFLNNKEMSDVTFLVEGRPFYAHKVLLFTASPRFKALLSSK.[3].DGTCIEIGYVKYSIFQLV 976
gi 512829085   807 PKLTEIKRKQTSRLDPQFLNNKEMSDITFIVEGRPFYAHKVLLFTASPRFKALLTNK.[3].ENSCIEINYVKYHIFQLV 884
gi 229485221   812 PKLTEIKKKQTSRLDPHFLNNKEMSDVTFLVEGKPFYAHKVLLFTASPRFKSLLSNR.[3].ENTCIEISHVKYNIFQLV 889
gi 927128914   900 PKLTEIKRKQTSRLDPHFLNNKEMSDVTFLVEGRPFYAHRVLLFTASPRFKALLSSK.[3].DSTFIEISYVKYPIFQLI 977
gi 1050386047  807 PKLTEIKRKQTSRLDPQFLNNKEMSDITFIVEGRPFYAHKVLLFTASPRFKALLTNK.[3].ENSCIEINYVKYHIFQLV 884

gi 269849706   977 MQYLYYGGPESLLIKNNEIMELLSAAKFFQLEALQRHCEIICAKSINTDNCVD 1029
gi 512829085   885 MQYLYCGGTESLLIKNNEIMELLSAAKFFQLEALQRHCEIICAKSINTENCVD 937
gi 229485221   890 MQYLYCGGTESLHIRNTEIMELLSAAKFFQLDALQRHCEIICSKNITNDSCVD 942
gi 927128914   978 MQYLYCGGSESLLIKNNEVMELLSAAKFFQLEALQRHCEIICAKSISTENCVD 1030
gi 1050386047  885 MQYLYCGGTESLLIKNNEIMELLSAAKFFQLEALQRHCEIICAKSINTENCVD 937
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap