Conserved Protein Domain Family
MYSc_Myh19

?
cd15896: MYSc_Myh19 
class II myosin heavy chain19, motor domain
Myosin motor domain of muscle myosin heavy chain 19. Class II myosins, also called conventional myosins, are the myosin type responsible for producing actomyosin contraction in metazoan muscle and non-muscle cells. Myosin II contains two heavy chains made up of the head (N-terminal) and tail (C-terminal) domains with a coiled-coil morphology that holds the two heavy chains together. The intermediate neck domain is the region creating the angle between the head and tail. It also contains 4 light chains which bind the heavy chains in the "neck" region between the head and tail. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. Class-II myosins are regulated by phosphorylation of the myosin light chain or by binding of Ca2+. A cyclical interaction between myosin and actin provides the driving force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. CyMoBase classifications were used to confirm and identify the myosins in this hierarchy.
Statistics
?
PSSM-Id: 276899
View PSSM: cd15896
Aligned: 5 rows
Threshold Bit Score: 1270.38
Threshold Setting Gi: 410901779
Created: 30-Nov-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
  next features
Feature 1:ATP binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

Feature 1                                    #########                                           #
XP_005163758   93 ASVLHNLKERYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVDMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTG 172  zebrafish
XP_003443121   93 ASVLHNLKERYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVDMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTG 172  Nile tilapia
XP_003964373   93 ASVLHNLKERYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTSYRSMMQDREDQSILCTG 172  torafugu
XP_004071883   93 ASVLHNLKERYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTG 172  Japanese medaka
XP_005802858   21 ASVLHNLKERYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTG 100  southern platyfish

Feature 1         #######                                               ###########               
XP_005163758  173 ESGAGKTENTKKVIQYLAHVASSHKTKKDQ     GELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYI 247  zebrafish
XP_003443121  173 ESGAGKTENTKKVIQYLAHIASSHKTKKDQ.[7].GELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYI 254  Nile tilapia
XP_003964373  173 ESGAGKTENTKKVIQYLAHVASSHKTKRDQ.[7].GELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYI 254  torafugu
XP_004071883  173 ESGAGKTENTKKVIQYLAHVASSHKTKKDQ.[7].GELEKQLLQANPILEAFGNAKTIKNDNSSRFGKFIRINFDVNGYI 254  Japanese medaka
XP_005802858  101 ESGAGKTENTKKVIQYLAHVASSHKTKKDQ     GELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYI 175  southern platyfish

Feature 1                                                                                         
XP_005163758  248 VGANIETYLLEKSRAIRQAKEERTFHMFYYMLTGVGDKLRSELCLEGYNKYRFLSNGNVTIPGQQDRDMYVETVEAMRIM 327  zebrafish
XP_003443121  255 VGANIETYLLEKSRAIRQAKEERTFHIFYYLLTGAGDKLRSDLLLENYNNYRFLSNGNVTIPGQQDKDLFTETMDAFRIM 334  Nile tilapia
XP_003964373  255 VGANIETYLLEKSRAIRQAKDERTFHIFYYLLTGAGDKMRNELLLENYNNYRFLSNGSITIPGQQDKDLFMETLEAMKIM 334  torafugu
XP_004071883  255 VGANIETYLLEKSRAIRQAKEERTFHIFYYLLTGAGDKLRKELLLENYNNYRFLSNGNVTIPGQQDKDLFNETMDAFKIM 334  Japanese medaka
XP_005802858  176 VGANIETYLLEKSRAIRQAKDERTFHIFYYMLTGAGDKLRNELLLENYNNYRFLSNGNVTIPGQQDKDLFTETMEAFRIM 255  southern platyfish

Feature 1                                                                                         
XP_005163758  328 GFSEEEHVGLLRVISSVLQLGNMSFKKERHSDQASMPDDTAAQKVCHLMGMNVTDFTRAILSPRIKVGRDYVQKAQTQEQ 407  zebrafish
XP_003443121  335 GIPEDEQIGLLKVVASVLQLGNMSFKKERHTDQASMPDNTAAQKVSHLMGMNVTDFTRAILSPRIKVGRDYVQKAQTQEQ 414  Nile tilapia
XP_003964373  335 SIPEDEQIGMLKVVASVLQLGNLNFKKERHTDQASMPDNTAAQKVCHLMGMNVMDFTRAILSPRIKVGRDYVQKAQTQEQ 414  torafugu
XP_004071883  335 SIPEEEQIGMLKVVASVLQLGNMSFKKERHTDQASMPDNTAAQKVSHLMGMNVTDFTRAILSPRIKVGRDYVQKAQTQEQ 414  Japanese medaka
XP_005802858  256 GIPEDEQIGMLKVVAAVLQLGNMSFKKERHTDQASMPDNTAAQKVCHLMGMNVTDFTRAILSPRIKVGRDYVQKAQTQEQ 335  southern platyfish

Feature 1                                                   ######                                
XP_005163758  408 AEFAVEALAKATYERMFRWLVMRINKALDKTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQ 487  zebrafish
XP_003443121  415 AEFAVEALAKATYERMFRWLVMRINKALDKTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQ 494  Nile tilapia
XP_003964373  415 AEFAVEALAKATYERMFRWLVMRINKALDKTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQ 494  torafugu
XP_004071883  415 AEFAVEALAKATYERMFRWLVMRINKALDKTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQ 494  Japanese medaka
XP_005802858  336 AEFAVEALAKATYERMFRWLVMRINKALDKTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQ 415  southern platyfish

Feature 1                                                                                         
XP_005163758  488 EEYQREGIEWSFIDFGLDLQPCIDLIEKPASPPGILALLDEECWFPKATDKSFVEKVLQEQGTHPKFHKPKKLKDEADFC 567  zebrafish
XP_003443121  495 EEYQREGIEWSFIDFGLDLQPCIELIEKPASPPGILALLDEECWFPKATDKSFVEKVLQEQGTHPKFFKPKKLKDEADFC 574  Nile tilapia
XP_003964373  495 EEYQREGIEWSFIDFGLDLQPCIDLIEKPANPPGILALLDEECWFPKATDKSFVEKVLQEQGTHPKFFKPKKLKDEADFC 574  torafugu
XP_004071883  495 EEYQREGIEWSFIDFGLDLQPCIELIEKPASPPGILALLDEECWFPKATDKSFVEKVFQEQGTHPKFFKPKKLKDDADFS 574  Japanese medaka
XP_005802858  416 EEYQREGIEWSFIDFGLDLQPCIDLIEKPASPPGILALLDEECWFPKATDKSFVEKVVQEQGTHPKFHKPKKLKDEADFC 495  southern platyfish

Feature 1                                                                                         
XP_005163758  568 IIHYAGKVDYKADEWLMKNMDPLNDNVATLLNQSTDRFVSELWKDVDRIVGLDKVAGM.[1].ELPGAFKTRKGMFRTVG 643  zebrafish
XP_003443121  575 IIHYAGKVDYKADEWLLKNMDPLNDNVATLLNQSTDKFVSELWKDVDSIVGLDKVTGM.[1].EMHGAFKTRKGMFRTVG 650  Nile tilapia
XP_003964373  575 VIHYAGKVDYKADEWLMKNMDPLNDNVATLLNQSTDKFISELWRDVDHIVGLDKVSGM.[1].EMPGAFKTRKGMFRTVG 650  torafugu
XP_004071883  575 IFHYAGKVDYKADEWLMKNMDPLNDNVTTLLNQSTDKFVSELWKDVDRIVGLDKVSGM.[1].EMPGAFKTRKGMFRTVG 650  Japanese medaka
XP_005802858  496 IIHYAGKVDYKADEWLMKNMDPLNDNVATLLNQSTDKFVSELWRDVDRIVGLDKVSGM.[1].EMPGAFKTRKGMFRTVG 571  southern platyfish

Feature 1                                                                                         
XP_005163758  644 QLYKEQLSKLMATLRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPN 723  zebrafish
XP_003443121  651 QLYKEQLSKLMATLRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPN 730  Nile tilapia
XP_003964373  651 QLYKEQLSKLMATLRNTNPNFVRCIIPNHEKKSGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIIFQEFRQRYEILTPN 730  torafugu
XP_004071883  651 QLYKEQLSKLMATLRNTNPNFVRCIIPNHEKKAGKLEPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPN 730  Japanese medaka
XP_005802858  572 QLYKEQLSKLMATLRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPN 651  southern platyfish

Feature 1                                              
XP_005163758  724 SIPKGFMDGKQACMLMIRALELDPNLYRIGQSKVFFR 760  zebrafish
XP_003443121  731 AIPKGFMDGKQACVLMIKSLELDPNLYRIGQSKVFFR 767  Nile tilapia
XP_003964373  731 AIPKGFMDGKQACMLMIKSLELDPNLYRMGQSKVFFR 767  torafugu
XP_004071883  731 AIPKGFMDGKQACVLMIKSLELDPNLYRIGQSKVFFR 767  Japanese medaka
XP_005802858  652 AIPKGFMDGKQACVLMIQSLELDANLYRIGQSKVFFR 688  southern platyfish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap