Conserved Protein Domain Family
MYSc_Myh18

?
cd14932: MYSc_Myh18 
class II myosin heavy chain 18, motor domain
Myosin motor domain of muscle myosin heavy chain 18. Class II myosins, also called conventional myosins, are the myosin type responsible for producing actomyosin contraction in metazoan muscle and non-muscle cells. Myosin II contains two heavy chains made up of the head (N-terminal) and tail (C-terminal) domains with a coiled-coil morphology that holds the two heavy chains together. The intermediate neck domain is the region creating the angle between the head and tail. It also contains 4 light chains which bind the heavy chains in the "neck" region between the head and tail. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. Class-II myosins are regulated by phosphorylation of the myosin light chain or by binding of Ca2+. A cyclical interaction between myosin and actin provides the driving force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. CyMoBase classifications were used to confirm and identify the myosins in this hierarchy.
Statistics
?
PSSM-Id: 276895
View PSSM: cd14932
Aligned: 8 rows
Threshold Bit Score: 1367.02
Threshold Setting Gi: 432843044
Created: 7-Jan-2013
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
  next features
Feature 1:ATP binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

Feature 1                                    #########                                           #
AAH45324       93 ASVLHNLRERYYSGLIYTYSGLFCVVINPYKYLPIYTEKIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTG 172  zebrafish
AAH60675       93 ASVLHNLRERYYSGLIYTYSGLFCVVINPYKYLPIYTEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTG 172  zebrafish
AAI29314       93 ASVLHNLRERYYSGLIYTYSGLFCVVINPYKYLPIYTEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTG 172  zebrafish
NP_001091647   93 ASVLHNLRERYYSGLIYTYSGLFCVVINPYKYLPIYTEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTG 172  zebrafish
XP_003447953   93 ASVLHNLKERYYSGLIYTYSGLFCVVINPYKHLPIYSEEIVNMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTG 172  Nile tilapia
XP_003972149   93 ASVLHNLKERYYSGLIYTYSGLFCVVVNPYKHLPIYSEDIVNMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTG 172  torafugu
XP_004065556   93 ASVLHNLKERYYSGLIYTYSGLFCVVINPYKHLPIYSEEIVNMYKGKKRHEMPPHIYAITDSAYRSMMQDREDQSILCTG 172  Japanese medaka
XP_005797606   93 ASVLHNLKERYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVNMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTG 172  southern platyfish

Feature 1         #######                                               ###########               
AAH45324      173 ESGAGKTENTKKVIQYLAYVASSFKTKKDQ.[7].GELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYI 254  zebrafish
AAH60675      173 ESGAGKTENTKKVIQYLAYVASSFKTKKDQ.[7].GELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYI 254  zebrafish
AAI29314      173 ESGAGKTENTKKVIQYLAYVASSFKTKKDQ.[7].GELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYI 254  zebrafish
NP_001091647  173 ESGAGKTENTKKVIQYLAYVASSFKTKKDQ.[7].GELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYI 254  zebrafish
XP_003447953  173 ESGAGKTENTKKVIQYLAHVASSFKSKKDQ.[7].GELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYI 254  Nile tilapia
XP_003972149  173 ESGAGKTENTKKVIQYLAYIASSFKSKKDQ.[7].GELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYI 254  torafugu
XP_004065556  173 ESGAGKTENTKKVIQYLAHVASSFKSKKDQ     GELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVTGYI 247  Japanese medaka
XP_005797606  173 ESGAGKTENTKKVIQYLAHVASSSKFKKDQ.[7].GELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYI 254  southern platyfish

Feature 1                                                                                         
AAH45324      255 VGANIETYLLEKSRAIRQAKDERAFHIFYYLLTGAGDKLRSELCLEDYNKYRFLSNGNVTIPGQQDRELFAETIDAFRIM 334  zebrafish
AAH60675      255 VGANIETYLLEKSRAIRQAKDERAFHIFYYLLTGAGDKLRSELCLEDYNKYRFLSNGNVTIPGQQDRELFAETIDAFRIM 334  zebrafish
AAI29314      255 VGANIETYLLEKSRAIRQAKDERAFHIFYYLLTGAGDKLRSELCLEDYNKYRFLSNGNVTIPGQQDRELFVETIDAFRIM 334  zebrafish
NP_001091647  255 VGANIETYLLEKSRAIRQAKDERAFHIFYYLLTGAGDKLRSELCLEDYNKYRFLSNGNVTIPGQQDRELFAETIDAFRIM 334  zebrafish
XP_003447953  255 VGANIETYLLEKSRAVRQAKDERSFHIFYYMLTGAGEKLRSELCLEDYSKYRFLSNGHVTIPGQQDKDLYAETMEAFNIM 334  Nile tilapia
XP_003972149  255 VGANIETYLLEKSRAIRQAKEERSFHIFYYLLTGAGDKLRSELCLEDYSKYRFLSNGNMTIPGLQDKELFAETMEAFHIM 334  torafugu
XP_004065556  248 VGANIETYLLEKSRGIRQAKDERSFHIFYYMLSGAGDKMRADLLLEDFSKYRFLSNGKVTIPGQQDKDLFNETMEAFNIM 327  Japanese medaka
XP_005797606  255 VGANIETYLLEKSRAIRQAKEERAFHIFYYMLTGAGDKMRSDLCLEDYSKYRFLSNGKVTIPGQTDKELFVETMEAFNIM 334  southern platyfish

Feature 1                                                                                         
AAH45324      335 GIPEDEQTGLLKVVSAVLQLGNMSFKKERNSDQASMPDDTAAQKVSHLLGMNVTDFTRAILSPRIKVGRDFVQKAQTQEQ 414  zebrafish
AAH60675      335 GIPEDEQTGLLKVVSAVLQLGNMSFKKERNSDQASMPDDTAAQKVSHLLGMNVTDFTRAILSPRIKVGRDFVQKAQTQEQ 414  zebrafish
AAI29314      335 GIPEDEQTGLLKVVSAVLQLGNMSFKKERNSDQASMPDDTAAQKVSHLLGMNVTDFTRAILSPRIKVGRDFVQKAQTQEQ 414  zebrafish
NP_001091647  335 GIPEDEQTGLLKVVSAVLQLGNMSFKKERNSDQASMPDDTAAQKVSHLLGMNVTDFTRAILSPRIKVGRDFVQKAQTQEQ 414  zebrafish
XP_003447953  335 SIPDEEITGLLKVVSAVLQLGNMTFKKERNSDQASMPDDTAAQKVCHLLGINVTDFTRAILSPRIKVGRDYVQKAQTQEQ 414  Nile tilapia
XP_003972149  335 SIPEEERIGFLKVVSAVLQLGNMTFKKERHSDQASMPDDTAAQKVCHLLSVNVTDFTRAILSPRIKVGRDYVQKAQTQEQ 414  torafugu
XP_004065556  328 SIPEEESTGLLKVVSAVLQLGNMSFKKERNSDQASMPDDTAAQKVCHLLGINVTDFTRAILSPRIKVGRDYVQKAQTQEQ 407  Japanese medaka
XP_005797606  335 SIPEEEINGLLKVISAVLQLGNMVFKKERNSDQASMPDDTAAQKVCHLLGINVTDFTRAILSPRIKVGRDYVQKAQTQEQ 414  southern platyfish

Feature 1                                                   ######                                
AAH45324      415 AEFAVEALAKATYERLFRWLVMRINKALDKTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQ 494  zebrafish
AAH60675      415 AEFAVEALAKATYERLFRWLVMRINKALDKTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQ 494  zebrafish
AAI29314      415 AEFAVEALAKATYERLFRWLVMRINKALDKTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQ 494  zebrafish
NP_001091647  415 AEFAVEALAKATYERLFRWLVMRINKALDKTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQ 494  zebrafish
XP_003447953  415 AEFAVEALAKASYERMFRWLVMRINKALDKTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQ 494  Nile tilapia
XP_003972149  415 AEFAVEALAKASYERMFRWLVFRINKALDKTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQ 494  torafugu
XP_004065556  408 AEFAVEALAKASYERMFRWLVLRINRALDKTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQ 487  Japanese medaka
XP_005797606  415 AEFAVEALAKASYERMFRWLVMRINKALDKTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQ 494  southern platyfish

Feature 1                                                                                         
AAH45324      495 EEYQREGIEWSFIDFGLDLQPCIELIEKPNGPPGILALLDEECWFPKATDKSFVEKVVQELGNNPKFQKPKKLKDDADFC 574  zebrafish
AAH60675      495 EEYQREGIEWSFIDFGLDLQPCIELIEKPNGPPGILALLDEECWFPKATDKSFVEKVVQELGNNPKFQKPKKLKDDADFC 574  zebrafish
AAI29314      495 EEYQREGIEWSFIDFGLDLQPCIELIEKPNGPPGILALLDEECWFPKATDKSFVEKVVQELGNNPKFQKPKKLKDDADFC 574  zebrafish
NP_001091647  495 EEYQREGIEWSFIDFGLDLQPCIELIEKPNGPPGILALLDEECWFPKATDKSFVEKVVQELGNNPKFQKPKKLKDDADFC 574  zebrafish
XP_003447953  495 EEYQREGIEWSFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDKSFVEKVSQEQGSHPKFQKPKKLKDDADFC 574  Nile tilapia
XP_003972149  495 EEYQREGIEWSFIDFGLDLQPCIELIDKPAGPPGILALLDEECWFPKATDKSFVEKVVQEQGTHPKFQKPKKLKDDVDFC 574  torafugu
XP_004065556  488 EEYQREGIEWSFIDFGLDLQPCIDLIERPAGPPGILALLDEECWFPKATDKSFVEKVAQEQGNHPKFQKPKKLKDDADFC 567  Japanese medaka
XP_005797606  495 EEYQREGIEWSFIDFGLDLQPCIDLIEKPNGPPGVLALLDEECWFPKATDKTFVEKLAQEQGTNPKFVKPKKLKDDADFC 574  southern platyfish

Feature 1                                                                                         
AAH45324      575 IIHYAGKVDYKANEWLMKNMDPLNDNVATLLNQSVDKFVSELWKDVDRIVGLDKVAGM.[2].SLHGAVKTRKGMFRTVG 651  zebrafish
AAH60675      575 IIHYAGKVDYKANEWLMKNMDPLNDNVATLLNQSVDKFVSELWKDVDRIVGLDKVAGM.[2].SLHGAVKTRKGMFRTVG 651  zebrafish
AAI29314      575 IIHYAGKVDYKANEWLMKNMDPLNDNVATLLNQSVDKFVSELWKDVDRIVGLDKVAGM.[2].SLHGAVKTRKGMFRTVG 651  zebrafish
NP_001091647  575 IIHYAGKVDYKANEWLMKNMDPLNDNVATLLNQSVDKFVSELWKDVDRIVGLDKVAGM.[2].SLHGAVKTRKGMFRTVG 651  zebrafish
XP_003447953  575 IIHYAGKVDYKANAWLMKNMDPLNECVATLLNQSTDKFTCDLWRDVDRIVGLDKVAGM.[2].SAQGAFKTRKGMFRTVG 651  Nile tilapia
XP_003972149  575 IIHYAGKVDYKADEWLMKNMDPLNESVATLLNQSTDKFTAELWRDMDHIVGLDKVAGM.[2].STYGAFKTRKGMFRTVG 651  torafugu
XP_004065556  568 IIHYAGKVDYKANEWLMKNMDPLNESVATLLNQSTDKFTADLWKDVDRIVGLDKVAGM.[2].SAHGAFKTRKGMFRTVG 644  Japanese medaka
XP_005797606  575 IIHYAGKVDYKANEWLMKNMDPLNECVATLLNQSTDKFIGDLWRDVDRIVGLDKVAGM     ADSGPFKTRKGMFRTVG 649  southern platyfish

Feature 1                                                                                         
AAH45324      652 QLYKEQLMNLMTTLRNTNPNFVRCIIPNHEKKAGKLAHHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPN 731  zebrafish
AAH60675      652 QLYKEQLMNLMTTLRNTNPNFVRCIIPNHEKKAGKLAHHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPN 731  zebrafish
AAI29314      652 QLYKEQLMNLMTTLRNTNPNFVRCIIPNHEKKAGKLAHHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPN 731  zebrafish
NP_001091647  652 QLYKEQLMNLMTTLRNTNPNFVRCIIPNHEKKAGKLAHHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPN 731  zebrafish
XP_003447953  652 QLYKEQLTNLMTTLRNTNPNFVRCIIPNHEKKAGKLEAHLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPT 731  Nile tilapia
XP_003972149  652 QLYKEQLGNLMTTLRNTNPNFVRCIIPNHEKKAGKLEPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQRYEILTPN 731  torafugu
XP_004065556  645 QLYKEQLGNLMTTLRNTNPNFVRCIIPNHEKKAGKLEPHLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPN 724  Japanese medaka
XP_005797606  650 QLYKEQLGNLMTTLRNTNPNFVRCIIPNHEKKAGKLDAHLVLDQLSCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPN 729  southern platyfish

Feature 1                                              
AAH45324      732 AIPKGFMDGKQACVLMVKALELDSNLYRIGQSKVFFR 768  zebrafish
AAH60675      732 AIPKGFMDGKQACVLMVKALELDSNLYRIGQSKVFFR 768  zebrafish
AAI29314      732 AIPKGFMDGKQACVLMVKALELDSNLYRIGQSKVFFR 768  zebrafish
NP_001091647  732 AIPKGFMDGKQACVLMVKALELDSNLYRIGQSKVFFR 768  zebrafish
XP_003447953  732 AIPKGFMDGKQACVLMIKALELDPNLYRIGQSKVFFR 768  Nile tilapia
XP_003972149  732 AIPKGFMDGKQACVLMIKALELDPNLYRIGQSKVFFR 768  torafugu
XP_004065556  725 AIPKGFMDGKQACVLMVKALELDPNLYRIGQSKVFFR 761  Japanese medaka
XP_005797606  730 AIPKGFMDGKQACVLMIKALELDPNLYRIGQSKVFFR 766  southern platyfish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap