Conserved Protein Domain Family
MYSc_Myh10

?
cd14920: MYSc_Myh10 
class II myosin heavy chain 10, motor domain
Myosin motor domain of non-muscle myosin heavy chain 10 (also called NMMHCB). Mutations in this gene have been associated with May-Hegglin anomaly and developmental defects in brain and heart. Multiple transcript variants encoding different isoforms have been found for this gene. Class II myosins, also called conventional myosins, are the myosin type responsible for producing actomyosin contraction in metazoan muscle and non-muscle cells. Myosin II contains two heavy chains made up of the head (N-terminal) and tail (C-terminal) domains with a coiled-coil morphology that holds the two heavy chains together. The intermediate neck domain is the region creating the angle between the head and tail. It also contains 4 light chains which bind the heavy chains in the "neck" region between the head and tail. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. Class-II myosins are regulated by phosphorylation of the myosin light chain or by binding of Ca2+. A cyclical interaction between myosin and actin provides the driving force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. CyMoBase classifications were used to confirm and identify the myosins in this hierarchy.
Statistics
?
PSSM-Id: 276952
View PSSM: cd14920
Aligned: 36 rows
Threshold Bit Score: 1419.39
Threshold Setting Gi: 432909796
Created: 7-Jan-2013
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
  next features
Feature 1:ATP binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

Feature 1                                    #########                                           #
Q61879         99 ASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTG 178  house mouse
AAA48985       99 ASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTG 178  chicken
AAA48986       99 ASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTG 178  chicken
AAA48987       99 ASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTG 178  chicken
NP_990805      99 ASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTG 178  chicken
NP_001084034   99 ASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTG 178  African clawed frog
AAI66177       99 ASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTG 178  western clawed frog
JAA50060       99 ASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTG 178  common vampire bat
XP_003451049   79 ASVLHNLRERYYSGLIYTYSGLFCVVVNPYKNLPIYTESIVEMYRGKKRHEMPPHIYAISEAAYRSMLQDREDQSILCTG 158  Nile tilapia
XP_003977677  108 ASVLHNLRERYYSGLIYTYSGLFCVVVNPYKNLPVYTESIVEMYRGKKRHEMPPHIYAISEAAYRSMLQDREDQAILCTG 187  torafugu

Feature 1         #######                                             ###########                 
Q61879        179 ESGAGKTENTKKVIQYLAHVASSHKGR.[ 6].GELERQLLQANPILESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVG 258  house mouse
AAA48985      179 ESGAGKTENTKKVIQYLAHVASSHKGR.[ 6].GELERQLLQANPILESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVG 258  chicken
AAA48986      179 ESGAGKTENTKKVIQYLAHVASSHKGR.[16].GELERQLLQANPILESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVG 268  chicken
AAA48987      179 ESGAGKTENTKKVIQYLAHVASSHKGR.[ 6].GELERQLLQANPILESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVG 258  chicken
NP_990805     179 ESGAGKTENTKKVIQYLAHVASSHKGR.[16].GELERQLLQANPILESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVG 268  chicken
NP_001084034  179 ESGAGKTENTKKVIQYLAHVASSHKGK.[22].GELERQLLQANPILESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVG 274  African clawed frog
AAI66177      179 ESGAGKTENTKKVIQYLAHVASSHKGK.[16].GELERQLLQANPILESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVG 268  western clawed frog
JAA50060      179 ESGAGKTENTKKVIQYLAHVASSHKGR.[ 6].GELERQLLQANPILESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVG 258  common vampire bat
XP_003451049  159 ESGAGKTENTKKVIQYLAHVASSHKGG.[10].GELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVAGYIVG 242  Nile tilapia
XP_003977677  188 ESGAGKTENTKKVIQYLAHVASSHKGS.[10].GELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVAGYIVG 271  torafugu

Feature 1                                                                                         
Q61879        259 ANIETYLLEKSRAVRQAKDERTFHIFYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGF 338  house mouse
AAA48985      259 ANIETYLLEKSRAVRQAKDERTFHIFYQLLAGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGF 338  chicken
AAA48986      269 ANIETYLLEKSRAVRQAKDERTFHIFYQLLAGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGF 348  chicken
AAA48987      259 ANIETYLLEKSRAVRQAKDERTFHIFYQLLAGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGF 338  chicken
NP_990805     269 ANIETYLLEKSRAVRQAKDERTFHIFYQLLAGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGF 348  chicken
NP_001084034  275 ANIETYLLEKSRAVRQAKDERTFHIFYQLLAGSGEHLKSDLLLDGFNNYRFVSNGYIPIPGQQDKDNFQETMEAMHIMGF 354  African clawed frog
AAI66177      269 ANIETYLLEKSRAIRQAKDERTFHIFYQLLAGSGEHLKSDLLLDGFNNYRFVSNGYIPIPGQQDKDNFQETMEAMHIMGF 348  western clawed frog
JAA50060      259 ANIETYLLEKSRAVRQAKDERTFHIFYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGF 338  common vampire bat
XP_003451049  243 ANIETYLLEKSRATRQAKDERTFHIFYQLLCGASEETRADLLLGTADQYRFLSGGSIPVPGQSDSENFTQTMDSMAIMGF 322  Nile tilapia
XP_003977677  272 ANIETYLLEKSRAIRQAKDERTFHVFYQMLCGTSEELKEELLLGSVDEYRFLTCGSIPVPGQSDSENFTQTMDSMAIMGF 351  torafugu

Feature 1                                                                                         
Q61879        339 SHEEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQAD 418  house mouse
AAA48985      339 SHDEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQAD 418  chicken
AAA48986      349 SHDEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQAD 428  chicken
AAA48987      339 SHDEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQAD 418  chicken
NP_990805     349 SHDEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQAD 428  chicken
NP_001084034  355 SHEEILSMLKVVSSVLQFGNIVFKKERNTDQASMPENTAAQKLCHLLGLNIMEFTRAILTPRIKVGRDYVQKAQTKEQAD 434  African clawed frog
AAI66177      349 SHEEILSMLKVVSAVLQFGNITFKKERNTDQASMPENTAAQKLCHLLGLNIMEFTRAILTPRIKVGRDYVQKAQTKEQAD 428  western clawed frog
JAA50060      339 SHEEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTAAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQAD 418  common vampire bat
XP_003451049  323 TPEELMSMLKVISAVLQFGNISFMKEKNHDQASMPDNTAAQKLCHLLGVNVLEFTRAILTPRIKVGREYVQKAQTKEQAD 402  Nile tilapia
XP_003977677  352 TPEENISMLKVISAVLQFGNISFMKEKHHDQASMPDNTAAQKLCHLLGINVLEFTRAILTPRIKVGREYVQKAQTKEQAD 431  torafugu

Feature 1                                                 ######                                  
Q61879        419 FAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEE 498  house mouse
AAA48985      419 FAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEE 498  chicken
AAA48986      429 FAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEE 508  chicken
AAA48987      419 FAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEE 498  chicken
NP_990805     429 FAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEE 508  chicken
NP_001084034  435 FAVEALRKATYERLFRWLVYRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEE 514  African clawed frog
AAI66177      429 FAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEE 508  western clawed frog
JAA50060      419 FAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEE 498  common vampire bat
XP_003451049  403 FAVEALAKATYERLFRWLVHRINRALDRRQRQGASFIGILDIAGFEIFQLNSFEQLCINYTNEKLQQLFNHTMFILEQEE 482  Nile tilapia
XP_003977677  432 FAVEALAKATYERLFRWLVHRINRALDRRQRQGASFIGILDIAGFEIFQLNSFEQLCINYTNEKLQQLFNHTMFILEQEE 511  torafugu

Feature 1                                                                                         
Q61879        499 YQREGIEWNFIDFGLDLQPCIDLIERP.[4].GVLALLDEECWFPKATDKTFVEKL.[10].QKPRQLKDKADFCIIHYA 581  house mouse
AAA48985      499 YQREGIEWNFIDFGLDLQPCIDLIERP.[4].GVLALLDEECWFPKATDKTFVEKL.[10].QKPRQLKDKADFCIIHYA 581  chicken
AAA48986      509 YQREGIEWNFIDFGLDLQPCIDLIERP.[4].GVLALLDEECWFPKATDKTFVEKL.[10].QKPRQLKDKADFCIIHYA 591  chicken
AAA48987      499 YQREGIEWNFIDFGLDLQPCIDLIERP.[4].GVLALLDEECWFPKATDKTFVEKL.[10].QKPRQLKDKADFCIIHYA 581  chicken
NP_990805     509 YQREGIEWNFIDFGLDLQPCIDLIERP.[4].GVLALLDEECWFPKATDKTFVEKL.[10].QKPRQLKDKADFCIIHYA 591  chicken
NP_001084034  515 YQREGIEWNFIDFGLDLQPCIDLIERP.[4].GVLALLDEECWFPKATDKTFVDKL.[10].QKPRQLKDKADFCIIHYA 597  African clawed frog
AAI66177      509 YQREGIEWNFIDFGLDLQPCIDLIERP.[4].GVLALLDEECWFPKATDKSFVDKL.[10].QKPRQLKDKADFCIIHYA 591  western clawed frog
JAA50060      499 YQREGIEWNFIDFGLDLQPCIDLIERP.[4].GVLALLDEECWFPKATDKTFVEKL.[10].QKPRQLKDKADFCIIHYA 581  common vampire bat
XP_003451049  483 YQREGIEWNFIDFGLDLQPCIDLIERP.[4].GVLALLDEECWFPRATDRSFVEKL.[10].FKSKQPRGEADFSIIHYA 565  Nile tilapia
XP_003977677  512 YQREGIEWNFIDFGLDLQPCIDLIEKS.[4].GVLALLDEECWFPRATDRSFVEKL.[10].FRSKQPRGEVDFSIIHYA 594  torafugu

Feature 1                                                                                         
Q61879        582 GKVDYKADEWLMKNMDPLNDNVATLLHQSSDRFVAELWK.[14].TETAFGSAYKTKKGMFRTVGQLYKESLTKLMATLR 669  house mouse
AAA48985      582 GKVDYKADEWLMKNMDPLNDNVATLLHQSSDKFVAELWK.[14].TETAFGSAYKTKKGMFRTVGQLYKESLTKLMATLR 669  chicken
AAA48986      592 GKVDYKADEWLMKNMDPLNDNVATLLHQSSDKFVAELWK.[14].TETAFGSAYKTKKGMFRTVGQLYKESLTKLMATLR 679  chicken
AAA48987      582 GKVDYKADEWLMKNMDPLNDNVATLLHQSSDKFVAELWK.[35].TETAFGSAYKTKKGMFRTVGQLYKESLTKLMATLR 690  chicken
NP_990805     592 GKVDYKADEWLMKNMDPLNDNVATLLHQSSDKFVAELWK.[35].TETAFGSAYKTKKGMFRTVGQLYKESLTKLMATLR 700  chicken
NP_001084034  598 GRVDYKADEWLLKNMDPLNDNVATLLHQSSDKFVSELWK.[14].AETAFGAAYKTKKGMFRTVGQLYKESLAKLMATLR 685  African clawed frog
AAI66177      592 GRVDYKADEWLMKNMDPLNDNVATLLHQSSDKFVGELWK.[14].AETAFGAAYKTKKGMFRTVGQLYKESLTKLMATLR 679  western clawed frog
JAA50060      582 GKVDYKADEWLMKNMDPLNDNIATLLHQSSDKFVAELWK.[14].TETAFGSAYKTKKGMFRTVGQLYKESLTKLMATLR 669  common vampire bat
XP_003451049  566 GKVDYKANDWLVKNMDPLNDNVASLLHQSSDHFVSELWK.[18].PVTFGAAGLKTKKGMFRTVGQLYKESLTKLMATLR 657  Nile tilapia
XP_003977677  595 GKVDYKADDWLVKNMDPLNDNVASLLHQSSDHFVSELWK.[42].PVTFGAGGLKTKKGMFRTVGQLYKESLTKLMATLR 710  torafugu

Feature 1                                                                                         
Q61879        670 NTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACER 749  house mouse
AAA48985      670 NTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACER 749  chicken
AAA48986      680 NTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACER 759  chicken
AAA48987      691 NTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACER 770  chicken
NP_990805     701 NTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACER 780  chicken
NP_001084034  686 NTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNSIPRGFMDGKQACER 765  African clawed frog
AAI66177      680 NTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACER 759  western clawed frog
JAA50060      670 NTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACER 749  common vampire bat
XP_003451049  658 NTNPNFLRCIIPNHEKRAGKLSPHLVLDQLRCNGVLEGIRICRQGFPNRIPFQEFRQRYEILTPNAIPRTFMDGKQASEL 737  Nile tilapia
XP_003977677  711 NTNPNFLRCIIPNHEKRAGKLAPHLVLDQLRCNGVLEGIRICRQGFPNRVPFQEFRQRYEILTPNAIPRTFMDGKQASEL 790  torafugu

Feature 1                               
Q61879        750 MIRALELDPNLYRIGQSKIFFR 771  house mouse
AAA48985      750 MIRALELDPNLYRIGQSKIFFR 771  chicken
AAA48986      760 MIRALELDPNLYRIGQSKIFFR 781  chicken
AAA48987      771 MIRALELDPNLYRIGQSKIFFR 792  chicken
NP_990805     781 MIRALELDPNLYRIGQSKIFFR 802  chicken
NP_001084034  766 MIRSLELDPNLYRIGQSKIFFR 787  African clawed frog
AAI66177      760 MIRALELDPNLYRIGQSKIFFR 781  western clawed frog
JAA50060      750 MIRALELDPNLYRIGQSKIFFR 771  common vampire bat
XP_003451049  738 MISALELDKNLFRVGQSKVFFR 759  Nile tilapia
XP_003977677  791 MIKALELDHNLFRVGQSKVFFR 812  torafugu

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap