1R4R,1R4I,2C7A


Conserved Protein Domain Family
NR_DBD_GR_like

?
cd06963: NR_DBD_GR_like 
Click on image for an interactive view with Cn3D
The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers
The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. It interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family of NRs includes four types of nuclear hormone receptors: glucocorticoid receptor (GR), mineralocorticoid receptor (MR), progesterone receptor (PR), and androgen receptor (AR). The receptors bind to common DNA elements containing a partial palindrome of the core sequence 5'-TGTTCT-3' with a 3bp spacer. These four receptors regulate some of the most fundamental physiological functions such as the stress response, metabolism, electrolyte homeostasis, immune function, growth, development, and reproduction. The NRs in this family have high sequence homology and share similar functional mechanisms. The dominant mechanism of function is by direct DNA binding and transcriptional regulation of target genes . The GR, MR, PR, and AR exhibit same modular structure. They have a central highly conserved DNA binding domain (DBD), a non-conserved N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 143521
View PSSM: cd06963
Aligned: 3 rows
Threshold Bit Score: 115.43
Threshold Setting Gi: 114793589
Created: 24-Nov-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:zinc binding site [ion binding site]
Evidence:
  • Structure:2C7A_A; C4 type zinc finger of human Progesterone Receptor, contacts determined at 4A
    View structure with Cn3D
  • Comment:Zinc finger, C4-type: The domain contains two groups of four Cys residues. Each group is involved in the co-ordination of a single zinc atom.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

Feature 1     #  #             #  #                  #     #         #  #                 
1R4R_A      7 CLVCSDEASGCHYGVLTCGSCKVFFKRAVEG.[2].NYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKT 79  Norway rat
1R4I_A     10 CLICGDEASGAHYGALTCGSCKVFFKRAAEG.[2].KYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKL 82  Norway rat
2C7A_A      5 CLICGDEASGCHYGVLTCGSCKVFFKRAMEG.[2].NYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKF 77  human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap