3CBB


Conserved Protein Domain Family
NR_DBD_HNF4A

?
cd06960: NR_DBD_HNF4A 
Click on image for an interactive view with Cn3D
DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers
DNA-binding domain of hepatocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. HNF4 interacts with a DNA site, composed of two direct repeats of AGTTCA with 1 bp spacer, which is upstream of target genes and modulates the rate of transcriptional initiation. HNF4 is a member of the nuclear receptor superfamily. HNF4 plays a key role in establishing and maintenance of hepatocyte differentiation in the liver. It is also expressed in gut, kidney, and pancreatic beta cells. HNF4 was originally classified as an orphan receptor, but later it is found that HNF4 binds with very high affinity to a variety of fatty acids. However, unlike other nuclear receptors, the ligands do not act as a molecular switch for HNF4. They seem to constantly bind to the receptor, which is constitutively active as a transcription activator. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, HNF4 has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 143518
View PSSM: cd06960
Aligned: 40 rows
Threshold Bit Score: 77.2296
Threshold Setting Gi: 7503362
Created: 21-Nov-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:zinc binding site [ion binding site]
Evidence:
  • Structure:3CBB_a; zinc binding site of human Hepatocyte Nuclear Factor 4alpha, contacts determined at 4A
    View structure with Cn3D
  • Comment:Zinc finger, C4-type: The domain contains two groups of four Cys residues. Each group is involved in the co-ordination of a single zinc atom.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

Feature 1        #  #             #  #               #         #         #  #                    
3CBB_A         3 CAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFS.[1].QCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERD 78  human
XP_001894913  15 CVICGEDSTGKHYGVIACLGCKTFFRRAVVHHQDIKCKRS.[1].CCEVVKDTRRACRACRYKKCLEMGMTKDALQPRRD 90  agent of lymphatic f...
CAP34796      20 CKICSYPAHGKHFGVMTCRACAVFFRRVVKLNLVYQCLKN.[2].KCSLNMIRRNSCRYCRFQKCLKMGMTLDAVDKNVD 96  Caenorhabditis briggsae
NP_494682     11 CAICRNKSSGCHYGVLSCDACKMFFKRTYLMEKYYTCRRQ.[1].SCYNMDGGNRKCKACRFKKCLEVGMNPELFSRSES 86  nematode
NP_871798     35 CAVCGDKSTGTHYGVISCNGCKGFFRRTVLRDQKFTCRFN.[1].RCVIDKNFRCACRYCRFQKCVQVGMKREAIQFERD 110 nematode
NP_509116     91 CSVCGDRPTGYHYDVLSCNGCKTFFRRTIINSRNFICTKG.[1].NCQFTKDFRCACRACRFEKCVRVGMNPSAIQFPSS 166 nematode
NP_500114     36 CAVCGDRVNGKRYGAPACLGCIVFFRRAVTNEVTYKCLKG.[1].TCVITNESRCICRYCRLQKCYTVGMKASAIQRRDV 111 nematode
Q9GTD4        11 CMVCSAPADGLHYGAISCRSCNAFFRRTVVEKAEYRCKHT.[1].TCLIDPDGRCACRSCRFTKCIEAGMKIGAVQPRRD 86  nematode
NP_507272     36 CKVCGDRPNNDRYGASACLGCTVFFRRAVVKNLKYKCMKE.[1].NCLISCTYRNACRYCRFQKCFAVGMHSSAIQRRDL 111 nematode
NP_510201     20 CVVCGDAADGFHYGVRSCRGCNAFFRRAVTFNMSFTCRRG.[1].RCPVDKNARCACRACRLAKCYAVGMDKKAVQPKRE 95  nematode

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap