1S1H


Conserved Protein Domain Family
Ribosomal_S23

?
cd03367: Ribosomal_S23 
Click on image for an interactive view with Cn3D
S12-like family, 40S ribosomal protein S23 subfamily; S23 is located at the interface of the large and small ribosomal subunits of eukaryotes, adjacent to the decoding center. It interacts with domain III of the eukaryotic elongation factor 2 (eEF2), which catalyzes the translocation of the growing peptidyl-tRNA to the P site to make room for the next aminoacyl-tRNA at the A (acceptor) site. Through its interaction with eEF2, S23 may play an important role in translocation. Also members of this subfamily are the archaeal 30S ribosomal S12 proteins. Prokaryotic S12 is essential for maintenance of a pretranslocation state and, together with S13, functions as control element for the rRNA- and tRNA-driven movements of translocation. S12 and S23 are also implicated in translation accuracy. Antibiotics such as streptomycin bind S12/S23 and cause the ribosome to misread the genetic code.
Statistics
?
PSSM-Id: 239465
Aligned: 38 rows
Threshold Bit Score: 185.936
Threshold Setting Gi: 40068578
Created: 5-Jan-2006
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 15 residues -Click on image for an interactive view with Cn3D
Feature 1:aminoacyl-tRNA interaction site (A-site) [nucleic acid binding site]
Evidence:
  • Comment:The A (acceptor)-site is the attachment site for an incoming aminoacyl-tRNA.
  • Comment:Based on aminoacyl-tRNA interaction with Escherichia coli S12.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

Feature 1                                             ######                    #########     
1S1H_L      1 NYKKRLLGTAFKSSPF.[1].GSSHAKGIVLEKLGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEVL 76  baker's yeast
O27129     23 HYKRRSLRLDVKADPL.[1].GAPQARGIVIEKVGIEAKQPNSAIRKCVRVQLIKNGKQITAFAPGDGAIGFIDEHDEVV 98  Methanothermobacter the...
Q9YAU5     29 EFRIRMLDLKRKYDPL.[1].GAPMARGIVLEKVGVEARQPNSALRKCVRVQLVKNKKVVTAFVPRDGGILYVDEHDEVI 104 Aeropyrum pernix
Q9HLY2     24 DYKRRVLQLKRKSDPL.[1].GAPQAKGIAIEKVGIEAKQPNSAIRKCVKVQLIKNGRQITAFAVGDGAINYIDEHDEVT 99  Thermoplasma acidophilum
O59229     29 RYKRRVLRLKEKSDPL.[1].GAPQARGIVLEKIAVEAKQPNSGMRKAVRVQLIKNGKVVTAFCPGDGAINFIDEHDEVI 104 Pyrococcus horikoshii
P39573     29 KYKTKILKLKEKYDPL.[1].GAPMARGIVLEKVGIESRQPNSAVRKCVRVQLVRNGRVVTAFVPGDGGVNFIDEHDEVI 104 Sulfolobus solfataricus
Q8TRC1     24 YYGRRVLGLNVKADPL.[1].GAPQGRGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGRQVTAFCPGDGAVNFIDEHDEVT 99  Methanosarcina acetivorans
Q8TXJ2     29 RYKRRMLKLDEKADPL.[1].GAPQARGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKQVTAFCPGDGAIDYIDEHDEVV 104 Methanopyrus kandleri
AAR38913   25 RYVRRMLRIKEKYDPL.[1].GAPMASGIVLEKTDVERRQPNSGRIKVVRVQLKKNGKVVTAFTPGDGAIKVIDEHDEVL 100 Nanoarchaeum equitans K...
AAB89362   26 RFVRRTLGLAAKADPL.[1].GAPMARGIVLEKIGIEARQPNSAIRKAVRVQLIKNGRQITAFCPGDGAINFIDEHDEVI 101 Archaeoglobus fulgidus ...

Feature 1                                                 
1S1H_L     77 LAGFGR     KGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEK 115 baker's yeast
O27129     99 VEGIGG.[1].SGRSMGDIPGVRWKVTKVNNVSLQEMVKGKIEK 138 Methanothermobacter thermautotrophicus str. Delta H
Q9YAU5    105 IEGIGG.[1].RGRSMGDIPGVRYRVVMVNGVSLKALWEGKKQK 144 Aeropyrum pernix
Q9HLY2    100 VEGIGG.[1].MGRSKGDIPGVRYKVVAVNGISLKELVKGRKEK 139 Thermoplasma acidophilum
O59229    105 IEGIGG.[1].KGGSMGDIPGIRYKVVKVNRVSLKELVKGRKEK 144 Pyrococcus horikoshii
P39573    105 ITGIGG.[1].LGRSMGDLPGVRYKVIMVNGVSLDALYKGKKQK 144 Sulfolobus solfataricus
Q8TRC1    100 VEKIGG.[1].MGGAMGDIPGVRFKVIAVNNVSLNQLVIGRMEK 139 Methanosarcina acetivorans
Q8TXJ2    105 IEGIGG.[1].KGRAKGDIPGVRYKVVKVNDVALSELLKGKIEK 144 Methanopyrus kandleri
AAR38913  101 IVGIRG.[1].QGRSMGDIPGVRYKVYLVNGQPLELLRKGKIEK 140 Nanoarchaeum equitans Kin4-M
AAB89362  102 VEKIGG.[1].MGRSMGDIPGVRYKVVKVNNTSLRELVRGRKEK 141 Archaeoglobus fulgidus DSM 4304

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap