Conserved Protein Domain Family
PTZ00121

?
PTZ00121: PTZ00121 
MAEBL; Provisional
Statistics
?
PSSM-Id: 173412
View PSSM: PTZ00121
Aligned: 2 rows
Threshold Bit Score: 2547.77
Threshold Setting Gi: 124804929
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

124804929    1 MGVLKHFFFLLFLYVNNTSAINNPQEEFMDRFDINKNHVNIKWSNSGIHGKGKFKYEIEERDVLS     EGNESEKSTI 75  
221056678    1 MTLYSFLALVAFYCICKAKRIANPQEAFMDRFDIAKNHINIKWSTNGRLGEGDYKYDIDDGENTD.[1].ELSTESMTGT 76  

124804929   76 CPNHVKEGTYKLGCPDYGKTFLMGFEDNKYSEEFLNEISFGFLNKKYKLPIEIPLNKSGLSMYQGLFKRCPYNKKHYSMI 155 
221056678   77 CPDNGAQEMYKGSCPDYGKTFVMDLNVDEYNEEFLDEMSFGLLNKKLNLSIEIPVEKSGMAMYQGLFKRCPLDENHSSLI 156 

124804929  156 KNENEYDMCFRKFYNNSNISTRIYKRGKQN.[1].KYIYFSSHGLGGRLGANIEEPLHKYKNDEHYVTKKMRYPEKIKNL 231 
221056678  157 RKEHVYDMCFERIYNRMELTDRNKKRTLRN     NYLHFGWHGLGGRFGSNIDYPLHDYNPSESHVTRKMGFSGLIRNL 231 

124804929  232 FDCSIYSHCIGPCLYKDFNNSCFLNLPILFNHQTKECVIIGTHEEKRIHNCQSGST.[1].QNIQRCFLPVKKEKGNQWT 307 
221056678  232 SDCSIYSYCMGPCFGKDFNNECFRSLPVVFNHRTKECVILGTHEASRRRNCLSQNS     YGFERCFVPMKKEAGKEWT 306 

124804929  308 YASSFIRTDYMTKCPPRFPLNHTMFGYFNYSTGKCETYYMNHEKR     TLSFSKCIETLFNNIKKQDDVNNSSFLWGV 382 
221056678  307 YASSFLRPDYETKCPPRFPLNDTVFGYYNHRTGECKSAVKNNRGN.[1].KSTFKNCIEGLFNHPEGDRGNGRNNFLWGV 382 

124804929  383 WTIENNANE.[3].LASMDNTGSCYFLKKKPTCVLKKENHFSFTILTANSFNLNQNIIYPELKNNSSKE     GSSLIH 455 
221056678  383 WFLEGSSEK     LSSMNDIGMCSILREKPNCVLKKEKHYSFTNLTANSFDFAQSVTYPQVEEMHDQE.[1].GVSNLG 453 

124804929  456 FKDPKQTNKRVLYENNKKSKRNVRTKINSVNPFTIPSTLNTNEKEEYNKN.[2].KNYPNNNISYIQKVHSSFVNNRFN 531 
221056678  454 ETAWEGREERIDLSEVDGKREEAGSEDKEIKETETYQNLQKNRKTEINEH     MGLSKENLNYMLPVQMRHESTHSN 527 

124804929  532 .[1].HSDSSFK     PIHKMIQMNIYTDNKLYNNNNQKIKDSN     NNMNGMSVTQRSPSIGENQNGNPQQKYMER 597 
221056678  528      RNDSIFR.[4].PISQMLELNQPSKSYLHNLGARGWGRYN.[6].RRINNGSVSQNEGNMSSKLSKNPQSKFMER 602 

124804929  598 FDIPNNHIFIEWQKEGEYGNDEFKYNIISNKTAGTSQSLFHNYKDKTCPNHVYEGRAHGSCPNYGKAIIVQNLLGEEYDK 677 
221056678  603 FDIPKNHIFINWKKDGEFGEGNLKYDILSNKTAGTAQSLLIDNYNDVCPNHSIPGRAQGSCPNYGKAIIVERPENKNEDS 682 

124804929  678 NFNLNFLNEIRTGYLNKYFKKDVEISYENSGIAMHNNMLRSCPVHENEEKLFSVKTDYNYKMCKSKIFSNRFTMKEYDPK 757 
221056678  683 NFNYESLNEIHTGYLGRISINVVELPYDKSGIAMHHGFPASCPIDKQEERLLQRMNDYNYDMCKSRVFPSPLSMKELDYR 762 

124804929  758 TRLFMYYGLYGLGGRLGANI     KRDKQKEKKYEDNITLPMKNPSLIKNLFDCSIYSYCLGPCLENSFGNKCFRNLPA 832 
221056678  763 NRTLKYYGLYGFGGRLGSTI.[3].SRNVGRGEKRTNNITLPMKNPGLINNLLDCSIYSYCLGPCMEGTYRNKCFRNLPA 840 

124804929  833 YYNHLTNECVILGTHEQERTNSCRRTKEEKKKPNCQILRKTTDSKDWTYVSSFIRPDYETKCPPRYPLKSKVFGTFDQKT 912 
221056678  841 YYNHATNECVILGTHEQERNSNCRKETSDLSRPNCQKIRKTLDSKDWTYVTSFIRPDYEEKCPPRFPLNSKSFGIYDERT 920 

124804929  913 GKCKSLMDKAYEVGINKFSVCLEYLFLVSPKDLYNSGRNNYWGIWAADHSVNENNIEIANGKCYHLVVKPTCVIDKENHF 992 
221056678  921 GKCRSLIGEDNYVGIQNFGGCLEYLFINSPKDLYNSDRKKYWGVWIGKEPVNDYNMFRVTGECYHILQKPTCVIHKENHF 1000

124804929  993 SFTALTANTVDFNQSVNIRKIEELTE.[9].EKEINNEPIDNVNETKINRKSHVNSMERNKPS.[2].ENEYDQMEKNVE 1073
221056678 1001 SFTSLTTNYIDFYQNFNIEPVEELVE     RRDIIDLDKEGNHYGRAEARAQVGQDRGLNPS     DFDFTAKKDSRA 1070

124804929 1074 DETYSEEFGLFEEARK.[4].RIEEESKKKEAMKRAEDARRIEEARRAEDARRIEEARRAEDAR.[5].RRVEDARRIEI 1152
221056678 1071 TEATEEAKKKAEEAKK     KAEEARKAEEAKKKAEEVRKAEEVRKAEEVRKAEEARKAEEDK     RKAEEARKAEE 1140

124804929 1153 SRRAEDAKRIEAARRAIEVRRA     ELRKAEDARRIEAARRYENERRIEEARRYEDEKRIEAVKRAEEVRKDEEEAKR 1227
221056678 1141 ARKAEEARKAEEARKAEEVRKA.[1].EVRKAEEVRKAEEARKAEEVRKAEEVRKAEEARKAEEVRKVEEAKKKAEEARK 1216

124804929 1228 AEKER.[23].KAEEKRKADELKKAEEKKKADELKKSEEKKKADELKKKAEEKKKADELKKKAEE     KKKADELKKK 1319
221056678 1217 AEEVR      KAEEARKAEEVRKAEEVRKAEEARKAEEVRKVEEAKKKAEEARKAEEAKKKAEE.[1].KKKAEAAKKK 1286

124804929 1320 AEEKKKADEVKKAEEKKKADELKKSEEKKKADELKKSEEKKKADELKKKAEEKKKADELKKKAEE     KKKADELKKK 1394
221056678 1287 AEEAKKKAEAAKKKAEAAKKKAEAAKKKAEAAKKKTEEAKKKAEAAKKKAEEVRKAEEAKKKAEE.[1].KKKAEEVKKA 1362

124804929 1395 AEEKKKADELKKKAEEKKKADELKKKAEEKKKADELKKKAEEKKKAENL     KKAEEKKKADELKKKAEEKKKADELK 1469
221056678 1363 EAAKKKAEEAKKKAEEVRKAEEAKKKAEEARKAEEAKKKAEEARKAEEA.[1].KKAEEARKAEEAKKKAEEARKAEEAK 1438

124804929 1470 KKAEE     KKKADELKKKAEEKKKADELKKAEEKKKADELKKAEEKKKADELKKAEEKKKADELKKAEELKKAEEKKK 1544
221056678 1439 KKAEE.[1].KKKAEEARKAEEAKKKAEEARKAEEARKAEEARKAEEARKAEEARKAEEVRKAEEVRKAEEVRKAEEVRK 1514

124804929 1545 VEQKKREEERR.[4].RRAEILKQIEKKR.[14].KAEQLKKEEEEK.[1].KAEQLKKEEEEKK.[9].EEEKKKAEQL 1631
221056678 1515 AEEARKAEEDK     RKAEEARKAEEAR      KAEEARKAEEAR     KAEEVRKAEEVRK     AEEVRKAEEV 1573

124804929 1632 KKEEE.[3].IKAEQLKKKEEEEKKKAEELKKEEEEEKKKAEQ.[2].KEEEEKKKVEQLKK.[2].EEEKKKAEQLKKE 1703
221056678 1574 RKAEE     VRKAEEARKAEEDKRKAEEARKAEEDKRKAEEA     RKAEEARKAEEVRK     AEEVRKAEEVRKA 1638

124804929 1704 EEEN.[2].KVEQLKKEEEEEKKKAEELKKEEEEKKKVQQ.[18].VIEEELKKED.[7].EKKIKDTKDNFENIQEGNN 1794
221056678 1639 EEVR     KAEEAKRKAEEDKRKAEEARVDEGEKNKIAH      VIKEGVDEKD     DRTTKDIFSNSAVIIEGGK 1702

124804929 1795 KNTPYIN     KEMFDSEIKEVVITKNMQLNEADAFEKH     NSENSKSSNKNADFSKEKDLLEDDIENILETDENE 1864
221056678 1703 EGNLVVN.[2].KETEVSATKEVADSSNSVREESKEVQQH.[4].NNISGEDGNSESNSNSETYNKEDFEEEVEEAKMIK 1778

124804929 1865 KINKDDIER     SNNNMKGNNNDIIYTKLDVEEYKKRDVNETREKIIKISKKNMCNNDFSSKYCDYMKDNISSGTCSN 1939
221056678 1779 QLDNNDMES.[2].PNSNYAPKNYESTDDKLDKDEYIKRNAEKTRQEIINLSKKDPCIVDVSSKFCDYMKENISSGNCSD 1855

124804929 1940 EERKSLCCSISDFCLKYFDHNSNKYYDCTKIEFADPLYRCFKKKEFSNMVYFAGAGIVLILLFVIGSKMIIGKWFEEATF 2019
221056678 1856 VERKELCCSISNYCLKYFSYSSNEYYNCMNEEFGHKDYKCFQKSKVSNTAYFAGAGIVLILLLVIVSKAILGKWFNEATF 1935

124804929 2020 DEMDLNYDKIYTLAMINNEETQVSNPLSYSEENIIK 2055
221056678 1936 DEFDENYEKVYTLAMINREQIQEAGSLDFSGYMSDK 1971
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap