Conserved Protein Domain Family
PTZ00014

?
PTZ00014: PTZ00014 
myosin-A; Provisional
Statistics
?
PSSM-Id: 240229
View PSSM: PTZ00014
Aligned: 16 rows
Threshold Bit Score: 1201
Threshold Setting Gi: 124505993
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

156083030    7 DEIATANALKRQGTAV.[3].DASD.[3].TGFQIWTDAAPSIKEDPSLLFVKCLVH.[1].GSTREKLICSQIEP 74  
66363150     1 MSAKDVKGLTRKVSGK.[3].DAKT.[1].KGSTVWCDSAPSVLNDPDSLFAKCIVQ.[1].GSTAEKLCLKEVDS 66  
71032757     7 EKLQTANALKRATSNL.[3].DSNG.[3].GGIYVWSDLAPAVKENPELMFAKCLVH.[1].GSTTEKLICSQVEP 74  
84999098     7 EKIQTANALKRATSNL.[3].DSNG.[3].NGVYVWSDLAPAVRENPELMFAKCLVH.[1].GSTTERLVCTQVEP 74  
209879237    1 MSARDVKGLTRKASGK.[3].DAKT.[1].KGTEVWCDSAPSVKDDPDSLFAKCVVL.[1].DSTASLLKLKESDS 66  
156094348    2 NKASELSNYFRINSEL.[1].NKIE.[3].EKFYVWTYKSPNVDRYPDLVFFKCLVL     SVDGDNYRVKEICP 66  
237831101   15 AKDSPEVKHFQRKSSV.[3].GRDG.[3].TNFTCWTADCPAVKADPTLVFAKCIVV.[1].GSMDTQLELEQVDP 82  
237832241    7 QDCKTAAALIRAGSLI.[3].ESAG     KDFLVWTTQGPAVKKDPDLLFSLCRVL.[1].GSTQQTLKLQQVEP 71  
237834595   15 PASAHGDKLRRGRTEV     DPKA.[3].QGMKIWTNNAPAVHANADECFALCLIL.[1].ESSETVLHLKQIDP 79  
221057285    2 NKASELSNYFRINSEF.[1].NKIE.[3].EKFYVWTYKSPNADRYPDVVFFKCLVL     SVDGDNYRVKEISP 66  

156083030   75 .[7].DKTFEVPLANAWNTNMSIDPMTYG.[1].IGMLPQTNIPCVLDYLRHRFMNNQIYSTADPLLVAINPFKDLGNAT 152 
66363150    67      NATFEAKIDSCFIANEPFDPNTYP.[1].IGLVPYTSIPCVLDFLKQRYLVNQIYTTADPLLVAINPFKDVGLVG 137 
71032757    75 .[7].KQKFEVPLANAWNTNSQIDPMTYG.[1].IGMLPQTSIPCVLDYLRHRFHKNQIYSTADPLMVSINPFKDLGNSG 152 
84999098    75 .[2].DEKFEVPLTNAWNTNSQIDPMTYG.[1].IGMLPQTSIPCVLDFLRHRFYKNQIYSTADPLMVSINPFKDLGNSG 147 
209879237   67      SVIFEAKPDTCYLANEPFDPNSYS.[1].IGLVPYTSIPCVLDFLKQRYMVNQIYTTADPLLVAINPFKDVGLVT 137 
156094348   67 .[2].NSEYVVKKEHLFNCNNMVNVNSHR     LNDMLHQNSAEVLNTLAMRYEKNFIYTIAEPMLISINPYQIIDVNM 138 
237831101   83 .[2].RGTFTVAPTDVFNANELIEPETVD.[1].IGYLPHTNVACVLDVLKSRFLRSIIYTTAEPLLVAINPFKDLGNTT 155 
237832241   72 .[3].SQELTVQAKEVWQANPGIDPLTYG.[1].IGGLPHTNEPCVLDFLARRYQSKVIYTTAEPLIVAVNPFQDLKNAG 145 
237834595   80 .[6].AESFTIDPEDAFNANIGIEVDKFP.[1].IGLLPHKNCAAVLDFLKQRYLLDLIYTTADPLLIAINPFKDLNNTT 156 
221057285   67 .[2].NSEYVVKKEHLFNCNNMVNVNSHR     LNDMVHQNSAEVLNTLAMRYEQNFIYTIAEPMLISINPYQIIDVNI 138 

156083030  153 DAV.[5].TAADSLKLAPHVFRTARMALENVYDYKYSQTIIVSGESGAGKTEATKQMMRYFAYSQKGETS.[2].IQTAI 229 
66363150   138 NDV.[5].DANDVSKLPPHVFAIAKRAFDNIMSVSRCQSILVCGESGAGKTEATKHVMKFFASSKSGTMD.[2].IQNAI 214 
71032757   153 QDV.[5].SAKSLMDMPPHVYYTSRRALENLHDYKYSQTIIVSGESGAGKTQSANMMMRYFASGSGLNKG.[2].IQQVV 229 
84999098   148 QDV.[5].RAKNLLDMPPHVYYTSRRALENLHDYKYSQTIIVSGESGAGKTQSANMMMRYFASGSGFTGG.[2].IQQVV 224 
209879237  138 NEK.[5].DIDDVSKLPPHVFAIAKRALDNLVTVARCQSILVCGESGAGKTEATKHIMKFFASSKSGNLD.[2].IQNAI 214 
156094348  139 EDY     KTRNSDELPPHVYTYAKDAMLDFINTKNCQSIIISGESGSGKTEASKLVIKFYLSGVKQDNS     ISKTL 208 
237831101  156 DAW.[5].NASKPEMLPPHVFKTARAALEDLEGYKKNQSIIVSGESGAGKTEATKQIMRFFASASSEVRT.[1].IQDTI 231 
237832241  146 PDT.[5].DAPDVDKLPPHVFYASRRAMTNMHQLKKPQTIIVSGESGAGKTETTKMLMKYLATSAGGNLD.[2].IQTAI 222 
237834595  157 PEW.[5].DAPDAEILAPHVFRLARTVLERLSAFMASQTIIVSGESGAGKTEATKQIMSYFAAGKRGEVS.[3].IQNAV 234 
221057285  139 DDY     KTRNSDELPPHVYTYAKDAMLDFINTRNSQSIIISGESGSGKTEASKLIIKFYLSGVKRDNN     ISKTL 208 

156083030  230 MAANPVLEAFGNAKTIRNNNSSRFGRFMQLDVSEEGGIRYGSVVAFLLEKSRIITQDSDERSYHIFYQFLKGAT     P 304 
66363150   215 MAANPVLEAFGNAKTTRNNNSSRFGRFMQLQLGKMGGIEYGVVRNFLLEKSRVITQESLERSYHIFYQLIKGAE.[2].P 291 
71032757   230 MAFNPVLESFGNAKTIRNNNSSRFGRFMQLDVAPEGGIRYGSIVTFLLEKSRLVTQDDDERSYHIFYQLLKGAN     D 304 
84999098   225 MAFNPVLESFGNAKTIRNNNSSRFGRFMQLDVAAEGGIRYGSIVTFLLEKSRIVTQDDDERSYHIFYQLLKGAN     D 299 
209879237  215 MAANPVLEAFGNAKTIRNNNSSRFGRFMQLQLGRMGGIEYGTVLNFLLEKSRVVTQEESERSYHIFYQILKGAD.[2].P 291 
156094348  209 WDSNFILEAFGNAKTIKNNNSSRYGKYIKIQLDENQNIVSSCIEIFLLEKIRVVSQEQEERCYHIFYEILQGMS     S 283 
237831101  232 MAGNPILEAFGNAKTIRNNNSSRFGRFMMLDVSSHRGIQHGSISNFLLEKVRVVSQEANERSYHIFYQLLKGAT     S 306 
237832241  223 MAANPVLEAFGNAKTVRNNNSSRFGRFMLLDVAREGGIQHGKVVAFLLEKSRIVCQDKDERSYHIFYQFLKGAP     G 297 
237834595  235 IAANPVLEAFGNAKTVRNNNSSRFGRFMQLQLGEKGGIEYGSIRNFLLEKVRVTSQEQHERSYHIFYQLVKGAD     D 309 
221057285  209 WDSNFILEAFGNAKTIKNNNSSRYGKYIKIQLDENQNIVSSCIEIFLLEKIRVVSQEQEERCYHIFYEILQGMS     N 283 

156083030  305 EMRNKYKLKGLNEYKFLN     PN     CLDVPSIDDVADFKEVLESFKNMGLGESE.[1].DTILSVLSGVLLMGNV 370 
66363150   292 GLKEKLKLKSLNEYKFIN     PE     CLDVETIDDVQDFKDVMQSFKTMGLSDSQ.[1].EDILSLVSGILLLGNV 357 
71032757   305 QLRSKLKLKRINEYAYLN     SK     CTEVNGVDDAKEFGLILNSFERMKLSEDQ.[1].ETVLSLLSGVLLLGNV 370 
84999098   300 QLRSKLKLKRIGEYEYLN     DK     CTEVNGVDDAKDFGLILNSFDQMKLTEEQ.[1].ETVLSLLSGVLLLGNV 365 
209879237  292 GLKEKLKLKGLTEYKFIN     PK     CLDVDNIDDVSDFKDVITSFKTMGLSESQ.[1].EDILSVVSGVMLLGNV 357 
156094348  284 EMKRKYNIKSETEYKYIS     NK     SVTIPEIDDAKDFENLMTSMDKMNMSSLK     DDLFLTLSGIMLLGNI 348 
237831101  307 EMRAKYHLRSLKEYAYLN.[1].KN.[2].CYDVPGIDDKADFEEVLQSLDAMQITGSK.[1].HSVFSILSGLLLIGNV 375 
237832241  298 HMRQRYMLQPLEAYTFIN     PH     CLDAPGIVDTEDFEQTVKSLESMNMTETE.[1].CTIWSIVSGVLLMGNA 363 
237834595  310 AKRRQLHLLNLEDYTYLS     KN.[2].CYDCPGIDDVKDFKEMNKSLRSIGLNLDD.[1].ESLWSIIAGVLLLGNV 377 
221057285  284 EMKKKYNIKSESEYKYIS     NK     SITIPEIDDAKDFENLMASMDKMNMSTLK     DDLFLTLSGILLLGNI 348 

156083030  371 EIGATSVDGIDDAAMIVNKD     VFNTACNLLYLDPALLETELTVKITSAGNNQIKGPRKKQDGEVLKTSVCKAIYER 445 
66363150   358 EIEPEDVGGGVEGSRIADSS.[2].SFNNAMELCKLDKEIVEKELIVKISYAGKNVIEGRFRPDETRMLKDSLAKGLYDK 434 
71032757   371 EVSGEERDGLTDAAVITNES     LLRDCAQLLYLDYDQLKYDLTMKKTMVGGGEIVSPRRKDESEVLKKSLSKAVYNK 445 
84999098   366 QISGEEREGLTDASVITNES     LLRDCAELLYLDYDQLKYDLTMKKTMVGGGEIVSPRRKDESEVLKKSLSKAVYNK 440 
209879237  358 EIESEDVGGGVEGAKIGESS.[2].IFNDAMELCKLDPASIEKELIVKITTAGKNIIEGRFRADESRMLKDSLAKGLYDK 434 
156094348  349 EFNEIEKGGKTNCSELSEEN.[2].VVQETSDLLGIDYVSLSNSLTFTEKNIAKQRIEIPLSVEESLSICRSISKDIYNK 425 
237831101  376 SIEGKDAQGVPDAAYISPQS.[2].ILEEACQLLSVDDAALKKEILVKSTKVGPQVIEGVRTKDEAKTSVLSLSKNVYDK 452 
237832241  364 KPTGKTEAGVENAACFVGES.[2].ALRNACSLLFLDYPSILHELTVKTTYAGSNKIESRWTVPDSEMLRASLAKGMYEQ 440 
237834595  378 HLESRETDGQPNAAALTPDG.[2].TLQKCCALLFVDEEAVKKEILYKVKTIGDQQIESPNSLSDALMNRDSLAKAVYEK 454 
221057285  349 EFNEIEKGGKTNCSELSEGN.[2].VVQETSDLLGIDYVSLSNNLTFTEKNIANQRIEIPLSVEESLSICRSISKDIYNK 425 

156083030  446 LFLWLIRNLNRSIEPPTG     FKTFIGMLDIFGFEVFKNNSLEQLFINITNEMLQTNFVDIVFKREAALYTNEGIPIP 520 
66363150   435 LFDYIILNLNENIKPPSG     FKVFCGMLDIFGFEVFKNNSLEQFFINVTNEYLQKNFTDIVFEKEQNLYSSEGISAA 509 
71032757   446 LFLWLVATVNKTIAPPEP     FKYFIGLLDIFGFEVFKNNSLEQLFINITNEMLQTNFVNIVFKREAQLYADEGIASP 520 
84999098   441 LFFWLVATVNKTIAPPEP     FKYFIGLLDIFGFEVFKNNSLEQLFINITNEMLQTNFVNIVFKREAQLYADEGIACP 515 
209879237  435 LFDYIILNLNKTIMPPQG     FNIFCGMLDIFGFEVFKNNSLEQFFINVTNEYLQKNFTDVVFEKEQKLYNDEGISTA 509 
156094348  426 IFEHITKKINEFLNNNKE     LDRYIGILDIFGFEIFLKNSLEQLLINIANEEIHNIYLYVVYEKESNLYKSEGIIAE 500 
237831101  453 LFDWLVRQLNSLIDAPDG     MPNFIGILDIFGFEVLEVNSLEQVLINITNEYLQKHFIDVVFDMETKLYQAEGVPTE 527 
237832241  441 LFLWIIRKLNADIEPKGG.[1].FDVFMGLLDIFGFEVFQNNSLEQLFINITNEVLQRNFTDIVFEKELQLYSKEGISSK 516 
237834595  455 LFDWVVRRVNATIEPPQG     FGIFMGMLDIFGFEMFENNSLEQLLINITNEQLQKNFIQIVFARETKLYYEEGIGNV 529 
221057285  426 IFEHMTMKINAFLNNNKE     LDKYIGILDIFGFEIFLKNSLEQLLINIANEEIHNIYLYVVYEKESNLYKSEGIIAE 500 

156083030  521 ELKYTSNADIIEVLCSK.[1].KSILSLLEDQCLAPGGTDENLVSSCNNQLKDNSKYSPAK.[2].AKLNFTVTHTIGTI 593 
66363150   510 NLEFKSNKMVLEALCDK.[1].NSILSAMEDQCLVPNGSDEKFLSAAYTNLKSNPCLKPAK.[2].GDVNFIVSHTIGDI 582 
71032757   521 KLEYESNSLVIELLCGK.[1].KSILSVLEDQCLAPGGNDMNLTSTCNTQLSNNPKYVKSK     QDKYFLVVHTIGPI 591 
84999098   516 NLEYESNSLVIDVLCGK.[1].KSVLSILEDQCLAPGGNDANLTSTCNTQLSNNPKYVKSR     QDKYFLIVHTIGPI 586 
209879237  510 NIEFKSNKQVLEVLCDK.[1].NSILSALEDQCLVPNGSDEKFLSAAYSNLKNNDSLKPAK.[2].GEKNFIVSHTIGDI 582 
156094348  501 SVKYTTNESIIDLLRGK     TSVISILEDSCLAPGKKDESIVGVYTNKFAKHPQYATCK.[2].MNGSFVIKHTVSDV 572 
237831101  528 ALEYTDNLALVGALCGK.[1].DSFFALLEDACLGIRSTDEGFCGTILRRLEPSGFFLESR.[2].KRLKFIIRHTIADI 600 
237832241  517 KIEYTTNEKLIETLLGK.[1].TSVLAALEDQCISPSGTDEKFVSSLASKLAGNKCFIPSK.[2].KSLEFTVVHTIGKV 589 
237834595  530 KITWTDNENVIKALCGK.[1].SSVLAILEDKSLAPGGTDEAIVTSMNQALKSSDVWKPGQ.[2].PRICFCICHTIADI 602 
221057285  501 SVKYTTNESIIDLLRGK     TSVISILEDACLAPGKKDESIVGVYTNKFAKHPQYLTCK.[2].MNGSFVIKHTVSDV 572 

156083030  594 SYNAQSFIFKNKDVLTAELVECVNASPNEMIKGLFENVVVTRG.[1].LAKGQLIGSQFMSQLDALMKLINSTDSHFIRC 669 
66363150   583 QYCASGFLFKNKDVLRAELVEVVQKSSNKLVADLFKDVFVERG.[1].MAKGQLIGSQFMNSLGSLMSIVNETEPHFIRC 658 
71032757   592 QYCSDGFINKNKDLLTGELVKLVNASQNPLVSELFKGDEVVSG.[1].LAKGMLIGSQFMSQLDSLMALINSTDSHFIRC 667 
84999098   587 QYCSDGFVTKNKDLLTGELVKLVNSSNNPLVSELFMGDEVVSG.[1].LAKGMLIGSQFMNQLDSLMTLINSTDPHFIRC 662 
209879237  583 QYCAEGFLFKNKDVLRAELVEVVQKSPNQLVADLFKGIVVERG.[1].IAKGQLIGNQFMNSLNSLMEIVDQTEPHFIRC 658 
156094348  573 TYSISNFISKNKDILSPNILRMLQVSKNDLVRSMYEDVEVTES     LGKKNLITFKYLENLQKISSYLKNTNIYFIKC 647 
237831101  601 EYTCEGMLEKNKDFLRKEVMDVMKASTDPVTKALFEGIEIEAG.[1].IGKGTLIASRFLKNLEEMIGIVAQTEAHFIRC 676 
237832241  590 IYNADGFAFKNKDVLRPEIIEITRASTNDVVRGLFEGVKVEKG.[1].MAKGMLIGSQFMTQLKGLMEVIQKTESHFIRC 665 
237834595  603 QYDATGFIEKNKDLLKPELCSIVQASSNNVAKELFEGVVMQKG.[1].IAKGQLIASQFMRSLDALLTLISSTESHFIRC 678 
221057285  573 TYSISNFISKNKDILSPNVLRMLKVSRNNLVRSMYEDVEATDS     LGRKNLITFKYLENLKKISSYLKNTNIYFIKC 647 

156083030  670 VKPNESKQPLDFNSVKILVQLHALSIIEALQLRKL.[1].YSYRRPYESFLEQYKYLDLSITNDKS.[1].DPKVAAERL 741 
66363150   659 VKPNESKKPLDWLASKVLIQLHSLSILEALQLRNL.[1].FSYRRTFSEFIYQFKYCDMSAANDKK.[1].DPKILAEKM 730 
71032757   668 ISPNDKMMPMTWNSVRVLLQLHALSVIEALQLRKL.[1].FSYRRTFAQFNEQYAYLNLAVVKDSR.[1].SDKDKAIKL 739 
84999098   663 ISPNDKMMPMTWNSVRVILQLHALSVIEALQLRKL.[1].FSYRRTFAQFNDQYAYLNLAVVKDSR.[1].SDKDKAIKL 734 
209879237  659 VKPNESKKPLDWVASKVLIQLHSLSILEALQLRNL.[1].YSYRRLFSEFIYQFKYCDLSIANDKE.[1].DPSILAQRM 730 
156094348  648 IKPNENKQKNNFNQRKVFPQLFSLSIVETLNIKYF     FQYKYTFSSFLSYYQYLDLPTSNDSS.[1].DDKGKVSKM 718 
237831101  677 LKPNEEKKPLGWNGSKVLNQLFSLSILEALQLRQV.[1].YAYRRNFSEFCSHFRWLDLGLVNSDR     DRKEVAQLL 747 
237832241  666 IKPNDDKVPLKWVNSKVLIQLHALSILEALHLRQL.[1].FSYRRTFEEFAAQFRFINLGVSNKPG.[1].DAKTICVEL 737 
237834595  679 LKPNETKNPHDWSNGKVLAQLFSLSILEALQLKNL.[1].FSYRRPYADFLKQFEQLDLEVTRKSG     NAKEKTKQL 749 
221057285  648 IKPNENKEKNNFNQRKVFPQLFSLSIIETLNIKYF     FQYKYTFASFLSYYQYLDLPISNDNT.[1].DDRSKVSKM 718 

156083030  742 ITS.[1].GVSKDQYAFGKSMMFLTQKLAKELTAIQRQRLSVWEPITAMIDAWITRQMAKKSLMSA     VEDIVRLQA 812 
66363150   731 LSG.[1].NIPKNSWAIGKTMVFLSKDAAKRMAQLQREKLAAFEPLVQLLEAVYLRYKLRREFRKN.[1].LKPLVRIQA 802 
71032757   740 VTE.[1].GLGNSDYAVGKTRMFLTRKAANKLTSIVRERLAKWAPLADLLEALLLRLQNQRELKKS     VKSIVRLQA 810 
84999098   735 VTE.[1].GLGTSDYAVGKTRMFLTRKAANHLTSIVRERLAKWAPLADLLEALLRRLQYQRELKKT     VKSIVRLQA 805 
209879237  731 LEI.[1].EIPKKEWAVGKTMVFLTKNAAKTMAHKQREKLAAFEPLVQLLEAVYLRYKLRKNFIKY.[1].LKPLTRIQA 802 
156094348  719 LQR     NFGDDSYKIGNTMVFLKKDAIHTIREIISNNLKSYKNLCSITSALITKIKKRTTVGEN     INHLQLAQA 788 
237831101  748 LEQ.[1].GIPESSWVIGKTMVFVKPDAAKELSILQREKLMCFQPLIGVLGPMWRKVLLRKKMARV     IHFLTRLES 818 
237832241  738 LKS.[1].SISADEYALGKTMVFLKPQAAKMLVRLQREALSAWEPLVGVFEGMTVLKRAKQLSTGR     AVPATRICA 808 
237834595  750 LTR.[1].NVPQAKWALGNTMVFMKPDAVRELTQKMRLIVVAWEPLIRVLEACHSRALKMRAIRDS     VQWVVRIQS 820 
221057285  719 LER     NFSDDSYKIGNTMVFLKKDAIHTIREIIYNNLRSYRNLCNITSALITKIKKKTTVEEN     IKHLQIAQA 788 

156083030  813 HLRRHIVESR.[3]. 825 
66363150   803 QLRRVLDIEI.[3]. 815 
71032757   811 HLRRVLNEGE.[3]. 823 
84999098   806 HLRRVLNEGE.[3]. 818 
209879237  803 QLRRVLDIEI.[3]. 815 
156094348  789 YFRKHKYIAQ.[2]. 800 
237831101  819 NARRHLEPDS.[3]. 831 
237832241  809 NVRRKLVQAG.[3]. 821 
237834595  821 QIRKARVIME      830 
221057285  789 YFRKHKYIAQ.[2]. 800 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap