Conserved Protein Domain Family
PRK13520

?
PRK13520: PRK13520 (this model, PSSM-Id:237409 is obsolete)
tyrosine decarboxylase MfnA
Statistics
?
PSSM-Id: 237409
View PSSM: PRK13520
Aligned: 50 rows
Threshold Bit Score: 530.996
Threshold Setting Gi: 222479026
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

297619856   2 .[2].SKEILSKLKEYRDLDLKYE.[2].NIFGSMCTKPHPITLEIIKMFYETNLGDPGLFIGTKKLEEESIQMIGKLLH 75 
148643047   6 .[2].KKDILKELNEIQSKDHKYS.[2].RILGSMCTEAHPFAKEVYCKFLDSNLGDPGLFKGTKYIENEVIKSIGELLS 79 
150401432   1 .[2].ERAVLEELKKYRKMDLKYE.[2].AILGSMCTKPHPITKKISDMFFETNLGDPGLFRGTKKLEDEVINNIGKFLN 74 
256811221   6 .[2].EREILEELMNYRKLDLKYE.[2].KIFGSMCSNVLPITRKIVDMFLETNLGDPGLFKGTKLLEEKAVELLGSLLN 79 
261403207   6 .[2].EKDILEELEKYRKMDLKYE.[2].KIFGSMCSNVLPITKKIVDMFLETNLGDPGLFKGTKILEEKAVSLLGSLMN 79 
288561152   6 .[2].EEEIFKELDFYQSQDCKYS.[2].RILGSMCTQAHPIAQKAFIQFLESNLGDPGLFKGTKAIEDKVLKMIGSFLS 79 
289191942   6 .[2].EREIFEELRKYRDLDLKYE.[2].KIFGSMCSNVLPITRKIVDMFLETNLGDPGLFKGTKLLEEKAIALLGEMLN 79 
296108740   1      MGRVIEELKRFRELDIKYS.[2].RIFGSMCSSIHPLAKEIVSLFLETNLGDPGLFKGTKLLEEKAVKLLGEILK 72 
304315245   6 .[2].EERVLEILEEFRSRDMTYT.[2].RILGSMCTSSHPLARRVYCDFLESNLGDPGLFRGTRELESCVIGMLGELLS 79 
15668221    9 .[2].EKEILEELKKYRSLDLKYE.[2].NIFGSMCSNVLPITRKIVDIFLETNLGDPGLFKGTKLLEEKAVALLGSLLN 82 

297619856  76 NPNAFGYIISGGTEANITAMRLFNNI.[3].NF.[14].SKIIIPETAHFSFDKSKDMMNLDLIRPPLTEYYTSNVKWVK 161
148643047  80 ISEPYGNIVTGGTEANIMAMRAARNH.[3].YK.[ 4].GEIIIPDSAHFSFKKAADMMNLKIIEAKLDENYKIDVDSVK 155
150401432  75 NPNPFGYIISGGTEANITAMRAINNI.[3].KR.[ 4].TTVIMPETAHFSFEKAREMMDLNLITPPLTKYYTMDLKYIN 150
256811221  80 NKKAYGHIVSGGTEANLMALRCIKNI.[8].LS.[ 4].PKIIIPITAHFSFEKGRDMMDLSYIYAPLKKDYTVDEKFVK 160
261403207  80 GKNVYGHIVSGGTEANLMALRCIKNI.[8].LT.[ 4].PKIVIPITAHFSFEKGRDMMDFDYIYAPIKDDYTIDIKFVK 160
288561152  80 IENPVGHIVTGGTEANIMAIRAARNI.[3].EK.[ 4].GEIIVPQSAHFSFKKASDILNLKLREIVLDDSYQLDASFVE 155
289191942  80 NKDAYGHIVSGGTEANLMALRCIKNI.[8].LS.[ 4].PKIIVPITAHFSFEKGREMMDLDYIYAPIKKDYTIDEKFVK 160
296108740  73 NKEPYGFIVSGGTEGNLLAMRVVKKM     KG      RTIILPKTAHFSFEKAKEMMDLNLVYAPLTKGYEIDVRFVK 141
304315245  80 EPAAAGHIITGGTEANLMAMRAARNM.[3].DK      PEVIVPKSAHFSFRKASDIMGLELREAELDRDYRVDVGSVR 151
15668221   83 NKDAYGHIVSGGTEANLMALRCIKNI.[8].LS.[ 4].PKIIVPITAHFSFEKGREMMDLEYIYAPIKEDYTIDEKFVK 163

297619856 162 DYVEDT.[8].ISGIVGIAGCTELGTIDNIKELSKIAYTNDIPLHVDAAFGGFVIPFLEEK.[5].YN.[2].FDFSL 239
148643047 156 ENISDN     TVAIVAIAGTTELGLVDPIEELSEIAYENNIYFHVDAAFGGFSIPFLRKI.[4].PP     FDFSL 222
150401432 151 DFIEDR.[7].VDGIVGIAGCTELGAIDNIKELSKIAEQNNIFLHVDAAFGGFVIPFLDDK.[5].YC.[2].FDFSL 227
256811221 161 DAVEDY.[1].IDGIVGIAGTTELGTIDNIEELSKIAKENNIYIHVDAAFGGLVIPFLEEK.[5].IN.[2].FDFSL 231
261403207 161 DTVEDE.[1].IDGIVGIAGTTELGTIDNIEKLSNISKEHNIYLHVDAAFGGLVIPFLEEK.[5].IS.[2].FDFSL 231
288561152 156 DEINEN     TVAIVGVAGTTELGMIDPIEELSNIALENNIHLHVDAAFGGFSIPFLKEI.[4].PE     FDFSL 222
289191942 161 DAVEDY.[1].IDGIIGIAGTTELGTIDNIEELSRIAKEYDIYIHVDAAFGGFVIPFLDDK.[5].VN.[2].FDFSL 231
296108740 142 DYVEDY.[1].VDGIVGIAGTTEFGTIDNIEKLSEIAKENDIYLHVDAAFGGFVIPFLPKE.[5].IN.[2].FDFSL 212
304315245 152 EMISDN     TVAIVGVAGTTELGRIDPIAELSDICIEEGVHLHVDAAFGGFIIPFLRDA.[4].PE     FDFKL 218
15668221  164 DAVEDY.[1].VDGIIGIAGTTELGTIDNIEELSKIAKENNIYIHVDAAFGGLVIPFLDDK.[5].VN.[2].FDFSL 234

297619856 240 .[1].GVKTITIDPHKMGLSPISAGGIIFRNREYKKYLDIEAPYLTETLQATILGTRTGVGAATTWGLLKLLCKDGYAKI 315
148643047 223 .[1].GVCSITVDPHKMGLAPIPAGGILFRKKEYLEVMAVDSPYLTVKTQSTIVGTRSGAASAATYAIMKYLGNEGYEKL 298
150401432 228 .[1].GVKSMTVDPHKMGLAPIPAGGILFRDKSFKKYLDVEAPYLTDIHQATIIGTRSGVGVASTWGVMKLFGEEGYKNL 303
256811221 232      GVDSITIDPHKMGHCPIPSGGILFKDISYRKYLDVYTPYLTETKQATILGTRVGFGGACTYAVLKYLGREGQRKI 306
261403207 232      GVDSITIDPHKMGHCPIPCGGILFKNETYRSYLDVNAPYLTETKQATILGTRVGFGGACTYAVLKLLGREGQRKI 306
288561152 223 .[1].GVKSITVDPHKMGLAPIPAGGILFRNEEYLDSISVNSPYLTIKHQSTIVGTRMGATSAATFAVMKYLGKDGYARL 298
289191942 232      GVDSITIDPHKMGHCPIPSGGILFKNIDYKKYLEVDAPYLTETKQATILGTRVGFGGACTYAVLRYLGREGQKKI 306
296108740 213      NVDSITIDPHKMLLCPIPAGGIIFKNSSYKRYLEVDAPYLTETKQATILGTRPGFGAACTYGLLRYFGEEGLKKL 287
304315245 219 .[1].GVSSITIDPHKMGLAPIPSGCILFRDETYLDAMSIETPYLTEKQQSTIVGTRTGASAAATWAVLRHMGRSGYREL 294
15668221  235      GVDSITIDPHKMGHCPIPSGGILFKDIGYKRYLDVDAPYLTETRQATILGTRVGFGGACTYAVLRYLGREGQRKI 309

297619856 316 THECMEKTTYLTNKLRENGFETVIEPVLNIIAIKDD     NAKETCKKLKEKGLYVSVCRCTNALRIVIMPHLEFEHLD 390
148643047 299 AGNLMDNTHYFKEGLEKIGYDVVVEPELNIVAFNHP.[2].EAHDLADKLEDLGWRVSVAKCPIAIRVVLMNHITKQHLT 375
150401432 304 ASECMDKTHYLVKEAKKLGFKPVIDPVLNIVALEDD     NPEETSLKLRKMGWFISICKCVKALRIIVMPHVEKEHID 378
256811221 307 VSECMENTLYLYKKLKENGFNPVIEPVLNIVAIEDE     DYKDVCMKLRDKGIYVSVCNCVKALRVVVMPHIKREHID 381
261403207 307 VSKCMDNTLYLSKKLKENGFETVINPILNIVAIRDE     NYKETCKNLKDRGIYVSICNCVEALRVVIMPHIKKEHID 381
288561152 299 AKESLDNAIFLAESVKQLGYELVVEPKLNIVAFNHP.[2].ETDDLAQLIEKRDWKVSCSSCPKAIRVILMNHIKREHIV 375
289191942 307 VSECMENTLYLYKKLKENGFKPVIEPILNIVAIEDE     NYKEVCKKLRDKGIYVSVCNCVEALRIVVMPHIRKEHID 381
296108740 288 VKEVMDRTFYFKERLEREGFKLLLEPILNIIAIEDE     NHIETCKKLKEMGYYPSVCFNAKALRIVVMPHIREEHID 362
304315245 295 ALRVMAVTSRLNEGLKDLGYEPVIEPELNIVAFNHP.[2].SPEKLASRLEEMGWAVSVSACPPAIRVVVMPHIKVEHIE 371
15668221  310 VNECMENTLYLYKKLKENNFKPVIEPILNIVAIEDE     DYKEVCKKLRDRGIYVSVCNCVKALRIVVMPHIKREHID 384

297619856 391 NLVNTLCKIN.[2]. 402
148643047 376 DLLDDLTEIY      385
150401432 379 KFLGALTEVK.[2]. 390
256811221 382 NFIEILKEVK.[2]. 393
261403207 382 NFIEQLCEVK.[2]. 393
288561152 376 ELISDLKDIS.[2]. 387
289191942 382 NFIEILKTIK.[2]. 393
296108740 363 NFIEVLKEVK.[2]. 374
304315245 372 LFLDDLKTLI      381
15668221  385 NFIEILNSIK.[2]. 396
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap