Conserved Protein Domain Family
PLN03032

?
PLN03032: PLN03032 
serine decarboxylase; Provisional
Statistics
?
PSSM-Id: 166673
View PSSM: PLN03032
Aligned: 5 rows
Threshold Bit Score: 730.857
Threshold Setting Gi: 159462858
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

159462858   1 .[8].AEMIGSYMKKLAERTHHHMGYPYNLDFDYGLLEGLTKYSINNLGDPFIESNYGVHSREFEVGVLNWFARLWEIDE 83 
168017461  18 .[8].ASVLARYRKSLTEKSKYHLGYPYNLDFDYGALSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEK 100
219115978   1      SDILHAYDQLLQSKSSVHFGYPYNLMFDYTELAQFMKYSINNLGDPFVPSNYGVHSRQFEVAVIDFFAKLWKMET 75 
168003181   6 .[8].AGILARYRKTLVEKTKFHLGYPYNLDFDYGALSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEK 88 
224006580   1      SDILASYDKLLKRKSSVHFGYPYNLMYNHEELYEFMKYSINNLGDPFITSNYGVHSRQFECSVIDFFAKLWKAEP 75 

159462858  84 EEYWGYITTCGTEGNLHGILVGRENFPDGVMYASSESHYSVFKAARMYRMEAEKVPTLESGEINYDDLKAALVKNAGKPA 163
168017461 101 DEYWGYITNCGTEGNLHGILVGREVLPDGILYASRDSHYSVFKAARMYRMEAVKVDTLLSGEIDCVDLERKLTEGKDKPA 180
219115978  76 DSYWGYVTTSGTEGNLHGILLAREKFPDGILYTSQETHYSVFKAARYYRMECQSIPTLPMGEIDYDCLSEAIARNRDKPV 155
168003181  89 EEYWGYITNCGTEGNLHGILVGREVLPDGILYASRDSHYSVFKAARMYRMEAVKVDTLLSGEIDCADFERKLTERKDKPA 168
224006580  76 DSYWGYVTTCGTEGNLHGILLARECHPDGILYSSRETHYSVFKAARYYRMDAKAIPTLPMGEIDYDALQSEIAKNRDRPV 155

159462858 164 ILNVNIGTTVKGAVDDLDRVLEVLKEAGYTEDRFYIHCDGALFGMMMPFLSR.[1].APMVTFRKPIGSVSVSGHKFVGA 239
168017461 181 ILNVNIGTTVKGAVDDLDLILKVLERVGYTEDRFYIHVDGALFGLMMPFVKK     APKVTFKKPIGSVSVSGHKFIGC 255
219115978 156 ILNVNIGTTVKGAVDNLDRILRILQSLQIPREQFYIHCDGALFALMMPFVEF     APEVSFRKPIDSIAVSGHKMLGC 230
168003181 169 ILNVNIGTTVKGAVDDLDLVLKTLEKVGYTEDRFYIHVDGALFGLMMPFVRR     APKVTFKKPIGSVSVSGHKFVGC 243
224006580 156 IINVNIGTTVKGAVDNLDRILRILKTLGIPRERFHIHCDGALFAMMMPFVDW     APEVSFQKPIDSIAVSGHKMLGC 230

159462858 240 PVPCGVIITRFKYVMALSSDVEYLNSRDATIMGSRNGHAPVYLWYTLTRKGYDGMRRDVEKCMRNAHVLQQMLESAGIRT 319
168017461 256 PMPCGVQFTRMKHINSLSRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKDVQRCLRNAHYLKERLREAKIGV 335
219115978 231 PMPCGVALSRKEHVKNLEQHIDYLNSVDTTIMGSRNGQAALYLWYSLRKKGIGGIKRDVMHCMETARYLKDALTAKGLTC 310
168003181 244 PMPCGVQITRMKHINVLSRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQRCLRNAYYLKERLREANVGV 323
224006580 231 PMPCGIALTRKEHVKKVEQKIDYLNSVDTTIMGSRNGQAALYLWYSLRKKGIAGIKRDVVHCMETAQYLRDKITEAGLTC 310

159462858 320 MLNELSNTVVFERPKEEAFVRKWQLACEGEIAHVVVMPNITVEKLEEFVADYVQ.[2]. 375
168017461 336 MLNELSSTVVFERPLDEAFILKWQLACQGKIAHAVVMPSVTVEKLDNFVEELIE.[2]. 391
219115978 311 RLNDLSSTVVLERPMDDDLVKRWQLACEEDIAHVVVMPNVTRYKIDLFVEELMQ      364
168003181 324 LLNELSSTVVFERPLDEAFILKWQLACQGKIAHAVVMPSVTVEKLDDFVEELIE.[2]. 379
224006580 311 RLNDLSSTVVLERPMDDAFIKRWQLACEEDIAHVVVMPNVTRFKIDKFVEELVE.[2]. 366
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap