Conserved Protein Domain Family
PLN02880

?
PLN02880: PLN02880 
tyrosine decarboxylase
Statistics
?
PSSM-Id: 215475
View PSSM: PLN02880
Aligned: 7 rows
Threshold Bit Score: 989.794
Threshold Setting Gi: 297832624
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

115471821   8 .[9].MDAEQLRECGHRMVDFVADYYKSIEAFPVLSQVQPGYLKEVLPDSAPRQPDTLDSLFDDIQQKIIPGVTHWQSPN 91 
30680963    3 .[9].MDSEQLREYGHLMVDFIADYYKTIEDFPVLSQVQPGYLHKLLPDSAPDHPETLDQVLDDVRAKILPGVTHWQSPS 86 
225437957  49 .[9].MDAEQLRENGHKMVDFIADYYKSIENFPVLSQVEPGYLRELLPDSAPNQPESLQQVFDDLQAKILPGVTHWQSPN 132
242043814   1      MDAEQLRECGHRMVDFVADYYKSIETFPVLSQVQPGYLKELLPDTAPNKPDTLEALFDDIREKIVPGVTHWQSPN 75 
224065523   1      MDSEQLRENAHKMVDFIADYYKSIENFPVLSQVEPGYLRELLPDSAPNQPETLQNVLDDVQAKILPGVTHWQSPS 75 
255571164   1 .[9].MDAEQLREHGHKMVDFIADYYKTIENFPVLSQVEPGYLRKLLPDSAPNQPESLQNVLDDVQAKILPGVTHWQSPN 84 
297832624   1      MDSEQLREYGHRMVDFIADYYKTIEDFPVLSQVQPGYLHKLLPDSAPDHPETLDQVLDDVRAKILPGVTHWQSPS 75 

115471821  92 YFAYYPSNSSTAGFLGEMLSAAFNIVGFSWITSPAATELEVIVLDWFAKMLQLPSQFLSTALGGGVIQGTASEAVLVALL 171
30680963   87 FFAYYPSNSSVAGFLGEMLSAGLGIVGFSWVTSPAATELEMIVLDWVAKLLNLPEQFMSKGNGGGVIQGSASEAVLVVLI 166
225437957 133 FFAYYPSNSSTAGFLGEMLSAGLNIVGFSWITSPAATELEMIVLDWLAKLLNLPDDFLSAGNGGGVIQGTASEAVLVVLL 212
242043814  76 YFAYYPSNSSTAGFLGEMLSAAFNIVGFSWITSPAATELEVIVLDWFAKMLRLPSQFLSTALGGGVIQGTASEAVLVVLL 155
224065523  76 YFAYYPSNSSVAGFLGEMLSAGINMVGFSWITSPAATELEMIVLDWLGKLLKLPEDFLSTGQGGGVIQGTASEAVLVVLL 155
255571164  85 YFAYYPSNSSVAGFLGEMLSAGINMVGFSWITSPAATELEMIVLDWLGKMLKLPEEFLSTGQGGGVIQGTASEAVLVALV 164
297832624  76 FFAYYPSNSSVAGFLGEMLSAGLGIVGFSWVTSPAATELEMIVLDWLAKLLNLPEQFMSKGNGGGVIQGSASEAVLVVLI 155

115471821 172 AARDRALKKHGKHSLEKLVVYASDQTHSALQKACQIAGIFSENVRVVIADCNKNYAVAPEAVSEALSIDLSSGLIPFFIC 251
30680963  167 AARDKVLRSVGKNALEKLVVYSSDQTHSALQKACQIAGIHPENCRVLTTDSSTNYALRPESLQEAVSRDLEAGLIPFFLC 246
225437957 213 AARDRVLRTVGKTALEKLVVYGSDQTHSALQKACQIGGIHPENCKLLKADSSTGYALSPDLLSEAVSHDITNGLIPFFLC 292
242043814 156 AARDRTLRKHGKTSLEKLVVYASDQTHSALQKACQIAGIFPENVRLVKADCNRNYAVAPLAISDAIATDLSSGLIPFFIC 235
224065523 156 AARDRVLRKLGKNALEKLVVYASDQTHSALQKACQIGGIHPENCKLLKTGSPTNYALSPDLLGKAISDDISTGLVPFFLC 235
255571164 165 AARDKVLRRVGKDALRKLVVYGSDQTHSALQKACQIGGIHPVNCRLLETDSSTNYALAPDLLSRAISEDISLGLIPFFLC 244
297832624 156 AARDKVLRSVGKNALQKLVVYSSDQTHSALQKACQIAGIHPENCRVLKTDSSTNYALRPELLQEAVSQDLDAGLIPFFLC 235

115471821 252 ATVGTTSSSAVDPLPELGQIAKSNDMWFHIDAAYAGSACICPEYRHHLNGVEEADSFNMNAHKWFLTNFDCSLLWVKDRS 331
30680963  247 ANVGTTSSTAVDPLAALGKIANSNGIWFHVDAAYAGSACICPEYRQYIDGVETADSFNMNAHKWFLTNFDCSLLWVKDQD 326
225437957 293 ANVGTTSSTAVDPLLELGKVTKSNGIWFHVDAAYAGSACVCPEYRHYIDGVEEADSFNMNAHKWFLTNFDCSVLWVKDRN 372
242043814 236 ATVGTTSSSAVDPLPELGQIAKANDMWLHIDAAYAGSACICPEYRHHLNGVEEADSFNMNAHKWFLTNFDCSLLWVKDRS 315
224065523 236 ATVGTTSSTAVDPLLSLGKIAKNNGIWFHVDAAYAGSACICPEYRCYIDGVEEADSFNMNAHKWFLTNFDCSALWVKDRN 315
255571164 245 ATVGTTSSTAVDPLLALGKIAKSNGMWFHVDAAYAGSACVCPEYRCYMDGVEEADSFNMNAHKWFLTNFDCSALWVKDRN 324
297832624 236 ANVGTTSSTAVDPLAALGKIANRNEMWFHVDAAYAGSACICPEYRQYIDGVETADSFNMNAHKWFLTNFDCSLLWVKDQD 315

115471821 332 FLIQSLSTNPEFLKNKASQANSVVDFKDWQIPLGRRFRSLKLWMVLRLYGVDNLQSYIRKHIHLAEHFEQLLLSDSRFEV 411
30680963  327 SLTLALSTNPEFLKNKASQANLVVDYKDWQIPLGRRFRSLKLWMVLRLYGSETLKSYIRNHIKLAKEFEQLVSQDPNFEI 406
225437957 373 ALVQALSTNPVFLKNKASDANMVVDYKDWQVPLGRRFRSLKLWMVLRLYGVENLQRYIRNHIKLAKQFEELVAQDPRFEI 452
242043814 316 YLIQSLSTNPEFLKNKASEANSVFDFKDWQIPLGRRFRSLKLWMVLRLYGVENLQSYIRKHIELAKEFEQLVISDSRFEV 395
224065523 316 ALIQSLSTNPEFLKNKASQANMVVDYKDWQIPLGRRFRSLKLWMVLRLYGLENLQCYIRNHINLAKYFEGLVAADSRFEV 395
255571164 325 ALIQSLSTSPEFLQNKPSQTNTVVDYKDWQIPLGRRFRSLKLWMVLRLYGVEKLQCYIRNHINLAKYFEGLIAEDTRFEV 404
297832624 316 SLTLALSTNPEFLKNKASQANLVVDYKDWQIPLGRRFRSLKLWMVLRLYGSETLKSYIRNHIKLAKEFEQLVSQDPNFEI 395

115471821 412 VTPRTFSLVCFRLVPPTSDHENGRKLNYDMMDGVNSSGKIFLSHTVLSGKFVLRFAVGAPLTEERHVDAAWKLLRDEATK 491
30680963  407 VTPRIFALVCFRLVPVKDEEKKCNNRNRELLDAVNSSGKLFMSHTALSGKIVLRCAIGAPLTEEKHVKEAWKIIQEEASY 486
225437957 453 VAPRKFALVCFRLLPPHRNEDFSNKLNHNLLDTVNSTGKVYISHTALSGKYTLRLAVGAPLTEERHVNAAWKVIQEKASV 532
242043814 396 VTPRTFSLVCFRLVPLASDQDNGRKLNYDLMDAANSSGKIFISHTVLSGKFVLRFAVGAPLTEGQHIFSAWKILQDLATK 475
224065523 396 VTPRIFSLVCFRLLPPNNNEDHGNNLNHDLLDAVNSTGKIFISHTVLSGKYILRFAVGAPLTEERHVTAAWKVLQDEASA 475
255571164 405 VSPPIFALVCFRLLPPDNNVDHGNKLSHDLLDAVNSTGKIFISHTVLSGKYILRFAVGAPLTEERHVTAAWKVLQDEACA 484
297832624 396 VTPRIFSLVCFRLVPVKNEEKKCNNRNRELLDAVNSSGKLFISHTALSGKIVLRCAIGAPLTEEKHVKEAWKVIQEEASY 475

115471821 492 VLGK 495
30680963  487 LLHK 490
225437957 533 LLSE 536
242043814 476 QLLE 479
224065523 476 LLGS 479
255571164 485 LLET 488
297832624 476 LLHK 479
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap