Conserved Protein Domain Family
PLN02590

?
PLN02590: PLN02590 
probable tyrosine decarboxylase
Statistics
?
PSSM-Id: 178200
View PSSM: PLN02590
Aligned: 3 rows
Threshold Bit Score: 1063.17
Threshold Setting Gi: 297803202
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

297803202   1 MHDREFGNGNGYSNGNG.[6].YTNGNGYTNGNGYSNGNGNVNGNGEANGAKVIKMKPMDSELLREQGHIMVDFIADYYK 81 
15235393    7 MYDREFGTGNGYSNGNG     YTNGNGHTNGNGNYNGNGHVNGNGKANGAKVVKMKPMDSELLREQGHIMVDFIADYYK 81 
145334161   7 MYDREFGTGNGYSNGNG     YTNGNGHTNGNGNYNGNGHVNGNGKANGAKVVKMKPMDSELLREQGHIMVDFIADYYK 81 

297803202  82 NLQDSPQDFPVLSQVQPGYLRDMLPDSAPDQPESLKELLDDVSKKIMPGITHWQSPSYFAYYASSTSVAGFLGEMLNAGL 161
15235393   82 NLQDSPQDFPVLSQVQPGYLRDMLPDSAPERPESLKELLDDVSKKIMPGITHWQSPSYFAYYASSTSVAGFLGEMLNAGL 161
145334161  82 NLQDSPQDFPVLSQVQPGYLRDMLPDSAPERPESLKELLDDVSKKIMPGITHWQSPSYFAYYASSTSVAGFLGEMLNAGL 161

297803202 162 SVVGFTWLTSPAATELEIIVLDWLAKLLQLPDHFLSTGNGGGVIQGTGCEAVLVVVLAARDRILKKVGKTLLPQLVAYAS 241
15235393  162 SVVGFTWLTSPAATELEIIVLDWLAKLLQLPDHFLSTGNGGGVIQGTGCEAVLVVVLAARDRILKKVGKTLLPQLVVYGS 241
145334161 162 SVVGFTWLTSPAATELEIIVLDWLAKLLQLPDHFLSTGNGGGVIQGTGCEAVLVVVLAARDRILKKVGKTLLPQLVVYGS 241

297803202 242 DQTHSSFRKACLIGGIHEENIRLLKTDSSTNYGMPPESLEEAISHDLAEGFIPFFICATVGTTSSAAVDPLVPLGKIAKK 321
15235393  242 DQTHSSFRKACLIGGIHEENIRLLKTDSSTNYGMPPESLEEAISHDLAKGFIPFFICATVGTTSSAAVDPLVPLGNIAKK 321
145334161 242 DQTHSSFRKACLIGGIHEENIRLLKTDSSTNYGMPPESLEEAISHDLAKGFIPFFICATVGTTSSAAVDPLVPLGNIAKK 321

297803202 322 YGIWMHVDAAYAGNACICPEYRKFIDGIENADSFNMNAHKWLFANQTCSPLWVKDRYSLIDALKTNPEYLEF     KVS 396
15235393  322 YGIWLHVDAAYAGNACICPEYRKFIDGIENADSFNMNAHKWLFANQTCSPLWVKDRYSLIDALKTNPEYLEF     KVS 396
145334161 322 YGIWLHVDAAYAGNACICPEYRKFIDGIENADSFNMNAHKWLFANQTCSPLWVKDRYSLIDALKTNPEYLEF.[2].KVS 398

297803202 397 KKDAVVNYKDWQISLSRRFRSLKLWMVLRLYGSENLRNFIRDHVNLAKHFEDYVAQDPHFEVVTTRYFSLVCFRLVPVDG 476
15235393  397 KKDTVVNYKDWQISLSRRFRSLKLWMVLRLYGSENLRNFIRDHVNLAKHFEDYVAQDPSFEVVTTRYFSLVCFRLAPVDG 476
145334161 399 KKDTVVNYKDWQISLSRRFRSLKLWMVLRLYGSENLRNFIRDHVNLAKHFEDYVAQDPSFEVVTTRYFSLVCFRLAPVDG 478

297803202 477 DEEKCNERNRELLAAVNSTGKIFISHTALSDKFILRFAVGAPLTEEKHVTEAWQIIQKHSSKFTCNGHY 545
15235393  477 DEDQCNERNRELLAAVNSTGKIFISHTALSGKFVLRFAVGAPLTEEKHVTEAWQIIQKHASKFTRNDHY 545
145334161 479 DEDQCNERNRELLAAVNSTGKIFISHTALSGKFVLRFAVGAPLTEEKHVTEAWQIIQKHASKFTRNDHY 547
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap