Conserved Protein Domain Family
pneumo_PspA

?
NF033930: pneumo_PspA 
pneumococcal surface protein A
The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
Statistics
?
PSSM-Id: 411490
View PSSM: NF033930
Aligned: 41 rows
Threshold Bit Score: 809.908
Threshold Setting Gi: 446958056
Created: 25-Aug-2020
Updated: 28-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

WP_001035318   1 MNKKKMILTSLASVAILGAGFVASSPTFVRAEEAP.[1].VVEKSSLEKKYEEAKAKYDAAKKDYD.[ 8].AQKKYEED 78  Streptococcus pneumo...
WP_001035388   1 MNKKKMILTSLASVAILGAGFVTSQPTVVRAEESP     VASQSKAEKDYDAAVKNATAAKKAAE.[11].AQKKYDED 80  Streptococcus pneumo...
WP_001035367   1 MNKKKMILTSLASVAILGAGFVTSQPTVVRAEEAP     VASQSKAEKDYDAAMKKSEAAKKDYE.[11].AQKKYDED 80  Streptococcus pneumo...
WP_001035356   1 MNKKKMILTSLASVAILGAGFVTSQPTFVRAEEAP     VASQSKAEKDYDAAVKKYEAAKKEYE.[ 4].AQKKYEDD 73  Streptococcus pneumo...
WP_001035358   1 MNKKKMILTSLASVAILGAGFVTSQPTFVRAEEAP     VASQSKAEKDYDTAKRDAENAKKALE.[ 4].AQKKYEDD 73  Streptococcus pneumo...
WP_001035359   1 MNKKKMILTSLASVAILGAGFVTSQPTFVRAEEAP     VASQSKAEKDYDTAKRDAENAKKALE.[ 4].AQKKYEDD 73  Streptococcus pneumo...
WP_001035336   1 MNKKKMILTSLASVAILGAGFVTSQPTFVRAEEAP     VANQSKAEKDYDAAKRDAENAKKALE.[ 4].AQKKYKDD 73  Streptococcus pneumo...
WP_001035314   1 MNKKKMILTSLASVAILGAGFVASQPTVVRAEEAP     VASQSKAEKDYDVAKRDAENAKKALE.[ 4].AQKKYEDD 73  Streptococcus pneumo...
WP_001035309   1 MNKKKMILTSLASVAILGAGFVASQPTVVRAEEAP     VASQSKAEKDYDAAKRDAENAKKALE.[ 4].AQKKYEDD 73  Streptococcus pneumo...
WP_001035312   1 MNKKKMILTSLASVAILGAGFVASQPTVVRAEEAP     VASQSKAEKDYDAAMEKYKAAEEDLK.[ 4].AQRKYDED 73  Streptococcus pneumo...

WP_001035318  79 QKKTEEKAKKEKEAAKEVDDASLAVQKAHVEYRKVLD.[13].KLAEADKKITEETTKLTNAQTKFQSIR.[1].TIVVP 161 Streptococcus pneumo...
WP_001035388  81 QKKTEEKAKEVKKASEEEQAANLKYQQELVKYIKYTR.[ 5].KRTEAEKVMTAAKKEHEKKQTELAKVL     AKVIP 154 Streptococcus pneumo...
WP_001035367  81 QKKTEAKAEEEKKASEAEQAANLKYQQELVKYIEYTR.[ 5].KKAKAEKAMAEAEKNYKEKQAEFAKVR     AKVIP 154 Streptococcus pneumo...
WP_001035356  74 QKKTEEKAEEERKASEEEQAANLKYQQELVKYIREND.[ 2].KKAEAKKAMDEAEKEYKKKQTEFAEVR     AKVIP 144 Streptococcus pneumo...
WP_001035358  74 QKKTEEKAKEEKQASEAEQKANLQYQLKLREYIQKTG      DRSKIQKEMEEAEKKHKNAKAEFDKVR     GKVIP 142 Streptococcus pneumo...
WP_001035359  74 QKKTEEKAKEEKQASEAEQKANLQYQLKLREYIQKTG      DRSKIQKEMEEAEKKHKNAKAEFDKVR     GKVIP 142 Streptococcus pneumo...
WP_001035336  74 QKITEEKAEEEKKASQEQQKANLDYQQKLRKYINEKD.[ 2].KRSMLQKEMEEAERKDKEKQAEFKKIR     EKVIP 144 Streptococcus pneumo...
WP_001035314  74 QKKTEEKAKEEKQASEAEQKANLKYQLLLQKYVSESD.[ 2].KKKEIEKQADAAKKENEIKKAELNKIR.[1].EIVVP 145 Streptococcus pneumo...
WP_001035309  74 QKKTEEKAKKEKEASKEEQAANLKYQQELVKYASEKD.[ 2].KKAKILKEVEEAEKEHKKKRAEFEKVR     SEVIP 144 Streptococcus pneumo...
WP_001035312  74 QKKTEEKAKETEEASKRQQAANLKYQLKLREYLKYIQ.[ 5].KIAKAEKEMNEAKQEEDKEKANLNKVL     AKVIP 147 Streptococcus pneumo...

WP_001035318 162 GQSELAETKKKAEEAKAEEKVAKRKYDYATLKVALAKKEVEAK.[9].EISTLEQEVATAQHQVDNLKKLLAGVDP 241 Streptococcus pneumoniae
WP_001035388 155 SAEELENTRQKAEKAKEKEPELTKKLEEAKAKSEEAEKKATEA.[9].EEVVPQAKIAELENEVQKLEKDLKEIDE 234 Streptococcus pneumoniae
WP_001035367 155 SAEELEETRQKAKEAKEKEPELTKKVAEAKAKLEEAEKKATEA.[6].EEVAPQAKIAELENQVHKLEQKLKEIDE 231 Streptococcus pneumoniae
WP_001035356 145 SAEELKKTRQKAEEAKAKEAELTKKVEEAEKKVTEAKQKVDAE.[2].EEVAPQAKIAELEHEVQKLEKALKEIDE 217 Streptococcus pneumoniae
WP_001035358 143 SAEELKETRRKAEEAKAKEAELTKKVEEAEKKVTEAKQKLDAE.[2].KEVALQAKIAELENQVHRLETELKEIDE 215 Streptococcus pneumoniae
WP_001035359 143 SAEELKETRRKAEEAKAKEAELTKKVEEAEKKVTEAKQKLDAE.[2].KEVALQAKIAELENQVHRLETELKEIDE 215 Streptococcus pneumoniae
WP_001035336 145 SAEELTETRRKAEEAEAKEPELTKKVKEAEEKVTEAKQKLDAE.[2].KEVALQAKIAELENEVHRLETKLKEIDE 217 Streptococcus pneumoniae
WP_001035314 146 SSQQLEVTRRKAEVAKAKEPGLRKRVEEAEKKVTEAKQKLDAE.[2].KEVALQAKIAELENEVYRLETELKGIDE 218 Streptococcus pneumoniae
WP_001035309 145 SAEELKKTRQKAEEAKAKEAELIKKVEEAEKKVTEAKQKLDAE.[2].KEVALQAKIAELENEVYRLETELKGIDE 217 Streptococcus pneumoniae
WP_001035312 148 SDRELEKTRQEAEKAKKNIPELKKKVEEAKQKVDAAKQKVDAE.[2].KEVAPQAKIAELENQVHRLEQDLKDINE 220 Streptococcus pneumoniae

WP_001035318 242      DDTEAIEAKLKK     GEAELNAKQAELA.[7].KL.[20].AELNKKVESLQNKVADLEKEISNLE.[65].L 386 Streptococcus pneumo...
WP_001035388 235 .[1].DSEDYVKEGLRA.[1].LQSELDAKQAKLS     KL      EELSDKIDELDAEIAKLEKNVEDFK.[ 1].S 290 Streptococcus pneumo...
WP_001035367 232 .[1].DSEDYVKEGFRA.[1].LQSELDAKQAKLS     KL      EELSDKIDELDAEIAKLEKDVEDFK.[ 1].S 287 Streptococcus pneumo...
WP_001035356 218 .[1].DSEDYVKEGLRA.[1].LQFELDVKQAKLS     KL      EELSDKIDELDAEIAKLEKDVEDFK.[ 1].S 273 Streptococcus pneumo...
WP_001035358 216 .[1].DSEDYVKEGLRV.[1].LQSELDVKQAKLS     KL      EELSDKIDELDAEIAKLEKDVEDFK.[ 1].S 271 Streptococcus pneumo...
WP_001035359 216 .[1].DSEDYVKEGLRV.[1].LQSELDVKQAKLS     KL      EELSDKIDELDAEIAKLEKDVEDFK.[ 1].S 271 Streptococcus pneumo...
WP_001035336 218 .[1].DSEDYVKEGLRA.[1].LQSELDAKQAKLS     KL      EELSDKIDELDAEIAKLEKDVEDFK.[ 1].S 273 Streptococcus pneumo...
WP_001035314 219 .[1].DSEDYVKEGLRA.[1].LQSELDAKRTKLS     TL      EELSDKIDELDAEIAKLEKNVEYFK.[ 1].T 274 Streptococcus pneumo...
WP_001035309 218 .[1].DSEDYVKEGLRA.[1].LQSELDAKRTKLS     TL      EELSDKIDELDAEIAKLEKNVEYFK.[ 1].T 273 Streptococcus pneumo...
WP_001035312 221 .[1].DSEDYVKEGLRA.[1].LQSELDTKKAKLL     KL      EELSGKIEELDAEIAELEVQLKDAE      G 275 Streptococcus pneumo...

WP_001035318 387 QNKVADLEKE.[18].ALQNKLATKKAELEKTQKELDAALNE.[2].PDGDEEE.[1].PA     PAPQ.[12].PAPA 472 Streptococcus pneumo...
WP_001035388 291 NGEQAEQYRA      AAEEDLAAKQAELEKTEADLKKAVNE.[2].KPAPAPE.[1].PA     PEAP.[11].PAPA 357 Streptococcus pneumo...
WP_001035367 288 DGEYSALYLE      AAEKDLVAKKAELEKTEADLKKAVNE.[2].KPAPAPE.[1].PA.[3].PAPA.[11].PAPA 357 Streptococcus pneumo...
WP_001035356 274 DGEQAGQYLA      AAEEDLVAKKAELEKTEADLKKAVNE     PEKPAEE.[1].PA     PAPK.[ 9].PAPA 336 Streptococcus pneumo...
WP_001035358 272 DGEYSALYLE      AAEKDLVAKKAELEKTEADLKKAVNE.[2].KPAEEPE.[1].PA     PAPK      PAPA 327 Streptococcus pneumo...
WP_001035359 272 DGEYSALYLE      AAEKDLVAKKAELEKTEADLKKAVNE.[2].KPAEEPE.[1].PA     PAPK.[11].PAPA 338 Streptococcus pneumo...
WP_001035336 274 DGEYSALYLE      AAEKDLAAKKAELEKTEADLKKAVNE.[2].KPAPAPE.[1].PA     PEAP.[11].PAPA 340 Streptococcus pneumo...
WP_001035314 275 DAEQTEQYLA      AAEKDLADKKAELEKTEADLKKAVNE     PEKPAEE.[1].PA     PAPK.[ 7].PKPA 335 Streptococcus pneumo...
WP_001035309 274 DAEQTEQYLA      AAEKDLADKKAELEKTEADLKKAVNE     PEKPAEE.[1].PA     PAPK.[ 7].PKPA 334 Streptococcus pneumo...
WP_001035312 276 NNNVEAYFKE      GLEKTTAEKKAELEKAEADLKKAVDE.[2].TPAPAPA     PA     PAPT.[15].PAPA 345 Streptococcus pneumo...

WP_001035318 473 PKPE.[1].PAPAP     KPEQ.[ 5].KPA.[2].P.[11].GWKQENGMWYFYNTDGSMATGWLQNNGSWYYLNANG 544 Streptococcus pneumo...
WP_001035388 358 PKPE.[1].PAEQP     KAEK.[30].KPA     P.[13].GWKQENGMWYFYNTDGSMATGWLQNNGSWYYLNSNG 454 Streptococcus pneumo...
WP_001035367 358 PKPE.[1].PAEQP     KPEK.[24].QPA     P.[13].GWKQENGMWYFYNTDGSMATGWLQNNGSWYYLNANG 448 Streptococcus pneumo...
WP_001035356 337 PQPE.[8].PAPAP     QPEK.[30].KPA     P.[ 4].GWKQENGMWYFYNTDGSMATGWLQNNGSWYYLNANG 431 Streptococcus pneumo...
WP_001035358 328 PQPE.[3].PAPAP     KPEK.[30].KPA.[2].P.[13].GWKQENGMWYFYNTDGSMATGWLQNNGSWYYLNSNG 428 Streptococcus pneumo...
WP_001035359 339 PKPE.[3].PAPAP     KPEQ.[21].QPA.[2].P.[13].GWKQENGMWYFYNTDGSMATGWLQNNGSWYYLNSNG 430 Streptococcus pneumo...
WP_001035336 341 PKPE.[1].PAEQP     KPEK.[30].KPA     P.[13].GWKQENGMWYFYNTDGSMATGWLQNNGSWYYLNSNG 437 Streptococcus pneumo...
WP_001035314 336 PAPQ     PAPAP     KPEK.[30].KPA     P.[13].GWKQENGMWYFYNTDGSMATGWLQNNGSWYYLNSNG 431 Streptococcus pneumo...
WP_001035309 335 PAPQ     PAPAP     KPEK.[30].KPA     P.[13].GWKQENGMWYFYNTDGSMATGWLQNNGSWYYLNSNG 430 Streptococcus pneumo...
WP_001035312 346 PKPA     PAPKP.[1].PAPK.[16].KPA.[4].P.[ 9].GWKQENGMWYFYNTDGSMATGWLQNNGSWYYLNANG 428 Streptococcus pneumo...

WP_001035318 545 SMATGWVKDGDTWYYLEASGAM.[1].ASQWFKVSDKWYYVNSNGAMATGWLQYNGSWYYLNSNGAMATGWLQYNGSWYY 620 Streptococcus pneumo...
WP_001035388 455 AMATGWLQNNGSWYYLNANGAM     ATGWLQNNGSWYYLHSNGAMATGWLQNNGSWYYLNSNGAMATGWLQNNGSWYY 529 Streptococcus pneumo...
WP_001035367 449 AMATGWLQNNGSWYYLNSNGAM     ATGWLQNNGSWYYLNANGAMATGWLQYNGSWYYLNANGAMATGWAKVNGSWYY 523 Streptococcus pneumo...
WP_001035356 432 AMATGWLQYNGSWYYLNANGAM     ATGWLQYNDSWYYLNANGAMATGWLQYNGSWYYLNANGAMATGWAKVNGSWYY 506 Streptococcus pneumo...
WP_001035358 429 AMATGWLQYNGSWYYLNANGAM     ATGWAKVNGSWYYLNANGAMATGWLQYNGSWYYLNASGAMATGWAKVNGSWYY 503 Streptococcus pneumo...
WP_001035359 431 AMATGWLQYNGSWYYLNANGAM     ATGWAKVNGSWYYLNANGAMATGWLQYNDSWYYLNANGAMATGWAKVNGSWYY 505 Streptococcus pneumo...
WP_001035336 438 AMATGWLQNNGSWYYLNANGAM     ATGWLQNNGSWYYLNSNGAMATGWLQYNGSWYYLNANGDMATGWLQNNGSWYY 512 Streptococcus pneumo...
WP_001035314 432 AMATGWLQYNGSWYYLNANGAM     ATGWAKVNGSWYYLNANGAMATGWLQYNDSWYYLNASGAMATGWAKVNGSWYY 506 Streptococcus pneumo...
WP_001035309 431 AMATGWLQYNDSWYYLNASGAM     ATGWAKVNGSWYYLNANGAMATGWLQYNDSWYYLNASGAMATGWAKVNGSWYY 505 Streptococcus pneumo...
WP_001035312 429 AMATGWAKVNGLWYYLNSNGAM     ATGWLQYNDSWYYLNTNGAMATGWLEYNGSWYYLNANGAMATGWLEYNGSWYY 503 Streptococcus pneumo...

WP_001035318 621 LNANGS.[41].MATGWLQYNGSWYYLNSNGAMATGWAKVNGSWYYLNANGSMATGWVKDGDTWYYLEASGAMKASQWFK 735 Streptococcus pneumo...
WP_001035388 530 LNANGA      MATGWLQNNGSWYYLNANGAMATGWAKVNGSWYYLNANGSMATGWVKDGDTWYYLEASGAMKASQWFK 603 Streptococcus pneumo...
WP_001035367 524 LNANGA      MATGWLQNNGSWYYLNANGAMATGWAKVNGSWYYLNANGSMATGWVKDGDTWYYLEASGAMKASQWFK 597 Streptococcus pneumo...
WP_001035356 507 LNANGA      MATGWLQYNGSWYYLNANGAMATGWAKVNGSWYYLNANGSMATGWVKDGDTWYYLEASGAMKASQWFK 580 Streptococcus pneumo...
WP_001035358 504 LNANGS      MATGWLQYNGSWYYLNANGAMATGWAKVNGSWYYLNANGSMATGWVKDGDTWYYLEASGAMKASQWFK 577 Streptococcus pneumo...
WP_001035359 506 LNANGA.[20].MATGWAKVNGSWYYLNANGSMATGWLQYNGSWYYLNANGSMATGWVKDGDTWYYLEASGAMKASQWFK 599 Streptococcus pneumo...
WP_001035336 513 LNANGA.[20].MATGWAKVNSSWYYLNANGAMATGWAKVNGSWYYLNANGSMATGWVKDGDTWYYLEASGAMKASQWFK 606 Streptococcus pneumo...
WP_001035314 507 LNANGA      MATGWLQYNGSWYYLNANGAMATGWAKVNGSWYYLNANGSMATGWVKDGDTWYYLEASGAMKASQWFK 580 Streptococcus pneumo...
WP_001035309 506 LNANGA      MATGWLQYNGSWYYLNANGAMATGWAKVNGSWYYLNANGSMATGWVKDGDTWYYLEASGAMKASQWFK 579 Streptococcus pneumo...
WP_001035312 504 LNSNGA      MATGWLQYNGSWYYLNANGAMATGWAKVNGSWYYLNANGSMATGWVKDGDTWYYLEASGAMKANQWFK 577 Streptococcus pneumo...

WP_001035318 736 VSDKWYYVNGLGALAVNTTVDGYRVNANGEWV 767 Streptococcus pneumoniae
WP_001035388 604 VSDKWYYVNGSGSLAVNTTVDGYTVNENGEWV 635 Streptococcus pneumoniae
WP_001035367 598 VSDKWYYVNGLGALAVNTTVDGYTVNENGEWV 629 Streptococcus pneumoniae
WP_001035356 581 VSDKWYYVNGLGALAVNTTVDGYKVNANGEWV 612 Streptococcus pneumoniae
WP_001035358 578 VSDKWYYVNGLGALAVNTTVDGYEVNANGEWV 609 Streptococcus pneumoniae
WP_001035359 600 VSDKWYYVNGLGALAVNTTVDGYKVNANGEWV 631 Streptococcus pneumoniae
WP_001035336 607 VSDKWYYVNGLGALAVNTTVDGYEVNANGEWV 638 Streptococcus pneumoniae
WP_001035314 581 VSDKWYYVNGLGALAVNTTVDGYEVNANGEWV 612 Streptococcus pneumoniae
WP_001035309 580 VSDKWYYVNGLGALAVNTTVDGYEVNANGEWV 611 Streptococcus pneumoniae
WP_001035312 578 VSDKWYYVNGLGALAVNTTVDGYTVNENGEWV 609 Streptococcus pneumoniae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap