Conserved Protein Domain Family
MARTX_Nterm

?
NF012221: MARTX_Nterm 
MARTX multifunctional-autoprocessing repeats-in-toxin holotoxin N-terminal region
This model describes the N-terminal 1900 amino acids of MARTX family multifunctional-autoprocessing repeats-in-toxin holotoxins, which contain both repeat regions that facilitate their entry into eukaryotic target cells, and multiple effector domains.
Statistics
?
PSSM-Id: 380155
View PSSM: NF012221
Aligned: 7 rows
Threshold Bit Score: 2891.84
Threshold Setting Gi: 968804200
Created: 25-Aug-2020
Updated: 28-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

CEF32352        1 MGKSASRSTAYAFTGKYEDDNDGNTIHAIGIDGVINAYGGNDYIVVVSARAVVNTTWGHDTIVGGAGYLDVNDTGGDLTV 80   Xenorhabdus nemato...
CAR44095        1 MMSKILKDLEFTFTGKRYGTDGNDDIDAIGFGGIIYAGKGHDTITVGTFAVTAYTGDGHDFVRGGSAYLKIIDENGDLDV 80   Proteus mirabilis ...
WP_060388862    1 MGKSVWRSIEYFFTGNYTADDGNNDIDAYGLGGVIHAYGGDDTIRVGSIGATVYTGTGNDSVYGGAAYLKVVDDSGNLTV 80   Aeromonas hydrophila
ABX24512        1 MGKPFWRSVEYFFTGNYSADDGNNDIVAIGMGGKIHAYGGDDHIHLGSLGATVYTGSGNDTVSAGAGYLKVEDTTGNLIV 80   Vibrio anguillarum
CSB02625        1 MGKPFWRSVEYFFTGNYSADDGNNNIVAIGFGGQIHAYGGDDHVTVGSIGATVYTGSGNDTVVGGSAYLKVEDSTGHLIV 80   Vibrio cholerae
AHI58932        1 MGKAFSRSTEYFFTGIYSADDDDNDIVAIGVGGEIHAGGGNDNITVVSAYTTAFTGSGDDSVQGAAGYMKVVDTSGHLKV 80   Moritella viscosa
WP_058589414    1 MGKSSNRSAEYFFTGRYYDDDDGNNIVAIGVGGIIYAKGGDDRITLGSIGATVYADSGNKVVNGGAGYLKIVDKEGNLAV 80   Photorhabdus laumo...

CEF32352       81 KGASGFTSINKTQSGPITFEGVSGGVKINHTG     DKSGIFYSGAAGYNSITRKGLQGDISFKGAGAYNELWHETNQG 155  Xenorhabdus nemato...
CAR44095       81 RGLNAWGEIEKSGHGDLKYVGASAAIKINHTG.[1].EYGNINYSGAAIANIITRKGAISNINYQGAGGYNQIWHETNTG 156  Proteus mirabilis ...
WP_060388862   81 KGAAGYADISKSQSGNVHFAGASGATNIDHQG     RDGDIRYQGAALANFLTRKGISGNVSFEGAGGYNKLWHQTDRG 155  Aeromonas hydrophila
ABX24512       81 RGAAGYANIKKNGDGNLSFSGAAAGVDIGHDG     QHGNISYAGAAAYNHIKRQGSSGHVSFQGAGGYNAIWHETNHG 155  Vibrio anguillarum
CSB02625       81 KGAAGYADINKSGDGNVSFAGAAGGVSIDHLG     NHGDVSYGGAAAYNGITRKGLSGNVTFAGAGGYNALWHETNQG 155  Vibrio cholerae
AHI58932       81 NGAAGYALINKSEDGDVSFTGLAGATKIAHSG     DHGRVTYTGAAASNKLERQGLTGNVTFEGAGGENKIWNGTNEG 155  Moritella viscosa
WP_058589414   81 HGAAGYSGIDKCGNGNISFTGTAGGVSMDHRG     DHGDLNFSGAAAYNGLNRQGQSGNVTFNGVGGYNELWHETNQG 155  Photorhabdus laumo...

CEF32352      156 NFSFAGAGGANKIDRT.[1].FNRYQGSHGDLTFKGAGAANIISSGVESGNVEFEGAGAANNIVRKGKIGDVTLRGAGAS 231  Xenorhabdus nemato...
CAR44095      157 NMTFKGGGGYNKLVRT.[1].FNSYQNSKGNINFEGLGGGNGIFSRVETGDIKFTGGGLENVLIREGKSGDIFMYGAGAN 232  Proteus mirabilis ...
WP_060388862  156 DLSYSGAGAANKLDRT.[1].HSQYQGSQGNIHFSGAGAANIISSQVESGNVTLNGAGAYNKVFRKGREGDVNFNGAGGW 231  Aeromonas hydrophila
ABX24512      156 NLSFEGAGAGNKIDRT.[1].FNQYQGSQGDVRFVGAGVANSISSRVESGNLHFSGAGADNHLVRKGKVGDITLAGAGAS 231  Vibrio anguillarum
CSB02625      156 NLSFTGAGAGNKLDRT.[1].SNRYQGSHGDVTFDGAGAANSISSRVETGNITFRGAGADNHLVRKGKVGDITLQGAGAS 231  Vibrio cholerae
AHI58932      156 NIYFAGAGAKNQLNRS     SSLYKRSSGEVTFNGIGASNIIRSQVETGNISFKGAGAENYIIREGKEGNVTFQGAGVS 230  Moritella viscosa
WP_058589414  156 NLNFAGAGAGNKIDRT.[1].YDHYEKSHGDVKFDGGGAANSISSRVESGNINFTGVGADNHLIRKGKEGNIILHGAGAS 231  Photorhabdus laumo...

CEF32352      232 NHVERIREA     DDVYSETKGNIRFEGVGGYNSLYSDVAHGDIHFAGAGGYNQITRKGT.[2].DVNSEGIQYAKAEA 303  Xenorhabdus nemato...
CAR44095      233 NRLTRISRN     TDTYKETSGNIYFSGGGGYNHIYSNIAQGNITFYGAGAYNEIIRTTQ.[2].PHNDLLVEYTKAEN 304  Proteus mirabilis ...
WP_060388862  232 NELSRLRNE     QDEYLQTRGDIRFNGAGGYNRLLSDVAEGNIHFKGAGGYNHLSRKGS     DSDSSPFAGARADE 301  Aeromonas hydrophila
ABX24512      232 NRIERTHNA     NDVYTETRGNIRFEGVGGYNSLYSDVAHGDIHFSGGGAYNTITRKGS.[2].DFDAQGMEYAKADE 303  Vibrio anguillarum
CSB02625      232 NRIERTHQA     EDVYTQTRGNIRFEGVGGYNSLYSDVAHGDIHFSGGGAYNTIIRKGS.[2].DFAKEGMTNAKADE 303  Vibrio cholerae
AHI58932      231 NRIERIHDS.[1].YDSYSETKGDIRFEGVGGYNSIKSDVAHGNIAFNGAGGFNYITREGA.[2].EYYGESLQNAKADE 303  Moritella viscosa
WP_058589414  232 NRIERLRQN     QDQYEQTHGNIEFEGTGGYNRIYSDIAHGDITFEGAGAYNEISRIGE.[2].DSRNEALEYAKAEE 303  Photorhabdus laumo...

CEF32352      304 IVLTKATMGGSWIGDT.[ 1].YQVTGLKSAQQPNTYLFAFVDGTHTKI      NKVQLRNDPQTGKLIYHSTSW 368  Xenorhabdus nematophil...
CAR44095      305 IFLTSAYMLNLDLDKS.[17].VEVKAIKSLREPNTYLFKTPGPGDTNL.[12].NKVKIYNDPETGKLQYDSELW 397  Proteus mirabilis HI4320
WP_060388862  302 IALTTATMGGSWINQS      QAVTAIKSSLQPNTYLFAFFDGMYTKV      NRVELSNDGANGALRYHATSW 365  Aeromonas hydrophila
ABX24512      304 IVLTAAQMHGLSIDNG.[ 3].HAVNAVKSEREPNTYLFAIADGHYTKI      NKIRLYNDAESGKLKYYSEAW 370  Vibrio anguillarum
CSB02625      304 IVLTKAVMSGSWIGQD      HHVTAVKSASEPNTYLFAFADSTYTKI      NKVQLRNDPQTGELKYYSTAW 367  Vibrio cholerae
AHI58932      304 IALTTAYLGGLGMIKP      VVVKGVKSTKEDNTYLFTYKDEVETKI      VKVKLSNDGVTGRLNYYATVW 367  Moritella viscosa
WP_058589414  304 IVLTTAMMGGSWIQQS      QQVTGIKSTAEPDTYLFAFADEMYTKI      SKVQLRNDPETGKLSYYATSW 367  Photorhabdus laumondii

CEF32352      369 .[21].NATNTDG.[62].DVNVVKSNRKP.[7].KVDSYTKIVV.[15].AQAW.[7].ANLGNEDISPDNGYQA 528  Xenorhabdus nematophil...
CAR44095      398       RITPDSG      DIRNIRFDKKN     FEDTYNLSVV      NNCW     NTLEKQEIIESPRFTK 445  Proteus mirabilis HI4320
WP_060388862  366 .[21].VSTQTDG.[62].DVNAVKSQKQA.[7].LLGTYTKIVV.[15].AKAW.[7].AGLADKVISEHTGFTA 525  Aeromonas hydrophila
ABX24512      371 .[21].ESNPVNG.[62].DVKAVKSNRKP.[7].MLGQHTKIVV.[15].ARSW.[7].ANLANQDISSAYGYHA 530  Vibrio anguillarum
CSB02625      368 .[21].TAVNING.[62].DVKAVKSNRQP.[7].VLGPYTKIVV.[15].ARSW.[7].ANIANQDISSATGYNP 527  Vibrio cholerae
AHI58932      368 .[23].EKIIADG.[62].DVQAVKSNKKP.[7].LQGENTKIVV.[15].ATSW.[7].ANLANEDISESNGYRH 529  Moritella viscosa
WP_058589414  368 .[21].FDIRSNG.[63].DVSAVKSNRQA.[7].YVESYTKVVM.[15].ASAW.[7].SNLAAEKVSPQNGYRS 528  Photorhabdus laumondii

CEF32352      529 .[3].GIYVLSDLHY     SAKAVRMSSGR     VAKMREYSDQELFQS.[1].TDSGESSGDVHYNGAGGGNVIKSN 592  Xenorhabdus nemato...
CAR44095      446 .[4].SHYQLSNLKV.[2].HINTEQIQRKS     LETIKLGVAQELFKD     DNSAECSGDINFTGGGAGNVIKSD 511  Proteus mirabilis ...
WP_060388862  526 .[3].GGYSLSEVRY     QLDTVTAVSDR     LPATREFSSQPLLPR.[1].QSGGKSKGDIFFDGAGGGNVIESD 589  Aeromonas hydrophila
ABX24512      531 .[3].EGYSLSDLHY     SVNTVRSTSET     VADIDESTDQTLFKP.[1].SDSGESSGDIHFNGVGGGNVIKSN 594  Vibrio anguillarum
CSB02625      528 .[3].GGYSLSDLHY     SVNAVRSTSET     VADIEEYTDQTLFKP.[1].NDSGESSGDVRFNGAGGGNVIKSN 591  Vibrio cholerae
AHI58932      530      AAHSLRDLNY     SVDTVRISSEV.[2].VADLTENRVNGLIQS.[1].ADFGESSGDVRFNGAGGGNVIKSN 592  Moritella viscosa
WP_058589414  529 .[3].GGYSLTNLQY     QVNTVRRVSEH     LAQTEEYSHQELVKS.[1].ADMGDSSGDINFKGMGGGNVITSS 592  Photorhabdus laumo...

CEF32352      593 VTRGNVYFNGA.[20].GGANVIIKKGKEGNLSFNGAGIANVLLHQSQHGDMNVNAGGAANVLVRVGDGRYLAHLLAVGN 686  Xenorhabdus nemato...
CAR44095      512 VTQGDINFTGG.[20].GAANIIVKKGQRGDLTFDGGGLANVLLHQSKEGRMNINATGATNVLIRIGDGEYKAHLTALGN 605  Proteus mirabilis ...
WP_060388862  590 VTEGNIHFNGA      GAANVLIKRGQRGDLVFRGAGLANVLVHQGAQGRMDVYAAGAANVLVRSGDGEYLARLLAYGN 663  Aeromonas hydrophila
ABX24512      595 VTRGHVYFNGG.[20].GAANVIVKSGEEGDLTFRGAGLANVLVHQSKQGKMDVYAGGAVNVLVRIGDGQYLAHLLAYGN 688  Vibrio anguillarum
CSB02625      592 VTRGNVHFNGG.[20].GAANVIVKSGEEGDLTFRGAGLANVLVHQSEQGKMDVYAGGAVNVLVRLGDGQYLAHLLAYGN 685  Vibrio cholerae
AHI58932      593 VTRGNVYFNGV.[20].GAANVIVKSGLEGDLTFRGAGLANVLVHQSKQGKMDVYAGGAVNVLVRIGDGQYLAHLLAYGN 686  Moritella viscosa
WP_058589414  593 VTRGNINFEGA      GAANVIVKKGEQGDLTFRGAGLANVLVHQGQRGEMDVYAGGAANVLVRIGDGRYLARLLAIGN 666  Photorhabdus laumo...

CEF32352      687 ISIHKGNGNSRISMGGGFNTHTQIGN     GDAFWTGVGGANVLTQTGNGDVSSILIGGANVLTKMGEGHLESAMFGGA 761  Xenorhabdus nemato...
CAR44095      606 VSIHKGQGDSHITMLGGLNTHTQIDS.[3].DKALWRALGGLNVMTQVGAGTITSLLGGGGNVLTKMGEGDLSSIMLGGA 683  Proteus mirabilis ...
WP_060388862  664 ISVQQGRGDSQVVMLGGYNTHTQLGD     GQGLWLAGGGFNLLTQVGNGRLDALSVGGANVLTKLGAGQLTAGLLGGA 738  Aeromonas hydrophila
ABX24512      689 ISVHKGNGNSRVVMLGGYNTHTQIGS     GNGLWLAAGGFNVMTQVGKGDVASVLAGGANVLTKVGDGDLTAGMLGGA 763  Vibrio anguillarum
CSB02625      686 ISVQKGSGDSRVVMLGGYNTHTQIGS     GNGLWLAAGGFNVMTQVGKGDVAAVLAGGANVLTKMGEGELTSGMLGGA 760  Vibrio cholerae
AHI58932      687 ISVHKGNGASRVVMFGGYNTHTQIGN     GNGTWAAAGGFNVMTQVGDGDITSVLVGGANVLTKIGDGDLTSGMIGGA 761  Moritella viscosa
WP_058589414  667 ISIHQGNGDSRVSMFGGYNTHSQIGN     GNANWLGAGGFNVMTQTGKGKVSSVLAGGANVLTKLGAGDLVAGMLGGA 741  Photorhabdus laumo...

CEF32352      762 NIITHI.[1].NNQGTS.[5].NTKAIALGGANVLTKKGKGDVQAVMGGGVNVLTHVGDGKTTGVMLGGANILTKVGNGD 837  Xenorhabdus nemato...
CAR44095      684 NIITHI.[1].NNKIKS     NTYTITLGGLNILTKKGQGDILAIMGGGGNVLTHIGNGNIHGVMLGGANILTKVGNGD 754  Proteus mirabilis ...
WP_060388862  739 NVLTHV.[1].QGEEAA     DTRAVLLGGANVLTKKGNGKVQAILGGGANVLTQIGQGDTQALLLGAANVLTRVGDGD 809  Aeromonas hydrophila
ABX24512      764 NVITHI.[1].GDNETS     NTTAVALGGANILTKKGKGNTLAVMGGGANVLTHVGDGTTTGVMVGGANILTKVGNGD 834  Vibrio anguillarum
CSB02625      761 NVITHI.[1].NDDQLS     NTTAVALGGANILTKKGKGNTLAVMGGGANVLTHVGDGTTTGVMVGGANILTKVGNGD 831  Vibrio cholerae
AHI58932      762 NIITHI.[1].GDEQSS     DTTAVALGGLNVLTKKGKGNALAVMAGGGNVLTHIGDGSTTGVMVGGANILTKVGDGD 832  Moritella viscosa
WP_058589414  742 NIITHL     NDGEIS     GTTAVALGGANILTKKGRGKAIALMGGGANVLTHIGNGSTTGMMLGGANILTKVGNGD 811  Photorhabdus laumo...

CEF32352      838 TTGIMFGLGNVLTHVGNGQTLGVMVSTGNIFTKVGNDTTIAAMIGVGNIFTHVGEGNAWALMGGAGNIFTKVGNGDALAL 917  Xenorhabdus nemato...
CAR44095      755 LSGIMLGIGNVLTHVGDGQTLGIMGAVGNIFTKVGNGTSMGAMVGGGNIFTHIGNGEAWALMGGLGNVYTKIGNGNTLAL 834  Proteus mirabilis ...
WP_060388862  810 LSAVMLGGANVLTHVGNGDTLGVMGAAGNLFTKVGDGTTIAAMIGAGNLFTQIGQGDAWALMGGVANVFTKVGDGNALAL 889  Aeromonas hydrophila
ABX24512      835 TTGIMLGVGNVLTHVGDGQTLGVMGAAGNIFTKVGDGTSIAVMIGAGNIFTHVGEGNAWALMGGLGNVFTKVGNGDALAL 914  Vibrio anguillarum
CSB02625      832 TTGILLGVGNVLTHVGDGQTLGVMGAAGNIFTKVGDGTSIAVMIGAGNIFTHVGEGNAWALMGGLGNVFTKVGNGDALAL 911  Vibrio cholerae
AHI58932      833 TTGIMLGLGNVLTHIGNGQTLGVMGAVGNVFTKVGDGTAIAAMVGAGNIFTHVGEGDSWALMGGVGNVFTKIGHGNALAL 912  Moritella viscosa
WP_058589414  812 ATGIMLGLGNVLTHVGSGQTLGVMGAAGNVFTKVGSGTTIAAMIGAGNIFTHVGNGDAWGLMGGLGNVFTKVGNGKALAL 891  Photorhabdus laumo...

CEF32352      918 MLAFGNVFTHVGDGMSVALMIAKGNIATKVGNGDVLSAMIGKGNIFTQIGHGSTFAAMIGGANVLTKVGDDLTAALMIGE 997  Xenorhabdus nemato...
CAR44095      835 MIAKGNVFTHVGDGMSVALMLAIGNIATKVGDGMTLAAMIGSANIFTHIGHEETFAAMVGKGNVLTKVGNGLTLGLMLGV 914  Proteus mirabilis ...
WP_060388862  890 MVAKANVFTHIGDGLTVALMLAQGNLATKVGNGMTLAAMVGNANVFTHVGAGETFAAMLGQANLFTKVGDGLTAALMIGK 969  Aeromonas hydrophila
ABX24512      915 MVAEANVFTHIGDGMSVALMLAKGNIATKVGNGTTLAAMVGNANIFTHVGSGSTFAAMIGQANIMTKVGDDLTAALMVGK 994  Vibrio anguillarum
CSB02625      912 MVAEANVFTHIGDGMSVALMLAKGNVATKVGNGTTLAAMVGNVNIFTHIGHGSTFAAMIGQANIMTKVGNDLTAALMVGK 991  Vibrio cholerae
AHI58932      913 MVAKANVFTHIGNGTTVALMLAEGNIATKIGNGMTMAAMVGNANIFTHVGDGETFAAMIGQANILTKVGNDVTAALMVGQ 992  Moritella viscosa
WP_058589414  892 MIAAGNVFTHIGDEMSVALMLAKGNIATKVGNGMMLAAMIGEANVMTHIGNGSTFAAMIGQGNILTKVGNDLALGLMVGE 971  Photorhabdus laumo...

CEF32352      998 ANIYTHVGKGTSIGLFGGSANIMTKVGDGTTLAAMFGKANIMTHVGDGLTGVLALGKANIVTKVGDDFMGVVAASEANIV 1077 Xenorhabdus nemato...
CAR44095      915 ANIYTHVGDGISIGLFSGKANIMTKVGNGTTLSAMFGKANIMTHIGDGITGILALGQANIITKVGDGIAGIIAGAKGNIV 994  Proteus mirabilis ...
WP_060388862  970 ANVYSHIGNGTSLGLFAGELNVMTKVGNGTTLAALFGKANIVTHVGGGLTGVLALGKANIITKVGDDFLGAIAKADANVL 1049 Aeromonas hydrophila
ABX24512      995 ANIYTHVGDGTSLGIFAGEVNVMTKVRNGTTLAAMFGKANIMTHVGDGLTGVLALGEANIVTKVGDDFMGVVAAAKANVV 1074 Vibrio anguillarum
CSB02625      992 ANIMTHVGDGTSLGLFAGEVNVMTKVGNGTTLAAMFGKANIMTHVGDGLTGVLALGEANIVTKLGDDFMGVVAAAKANVV 1071 Vibrio cholerae
AHI58932      993 ANIYTHVGDGTSIGILAGEANIMTKVGNGTTLAAMFARANIMTHVGDGLTGVLALGQANIVTKVGDSFMGVVAAAKANVV 1072 Moritella viscosa
WP_058589414  972 ANIYSHVGNGTSIGLFAGELNVMTRVGDGTTLAAMFGQANIMTHSGNGLTGVLALGEANIVTKVGDDFMGVVAAAEANVI 1051 Photorhabdus laumo...

CEF32352     1078 THVGDGTTAALLSGKGNILTKVGDGTTVGLLKSEIGNIMTHLGDGTTVGFAKGDANIITKVGDGLGINAAWGKANVMTHV 1157 Xenorhabdus nemato...
CAR44095      995 THVGDGITAAILGGKANILTKVGDGLTVGLLISKVGNIMTHIGNSTTIGFAKGNANIITKVGYGLGINAAWGKANIFTHI 1074 Proteus mirabilis ...
WP_060388862 1050 THVGNGTTAGVLWGKGNLLTKIGDGTTVGLLISEVGNVMTHVGAGSTIGLAKGRANLITKVGDGLVVQGAWGDVNLLTQV 1129 Aeromonas hydrophila
ABX24512     1075 THVGDATTAAVLAGKGNILTKVGEGTTVGLLISDIGNVMTHVGDGTTIGIAKGKANIITKVGDGLGVNVAWGQANVFTHV 1154 Vibrio anguillarum
CSB02625     1072 THVGDATTAAVLAGKGNILTKVGEGTTVGLLISDVGNVMTHVGDGTTIGIAKGKANLITKVGDGLGVNVTWGQANVFTQV 1151 Vibrio cholerae
AHI58932     1073 THVGDATTAAVLLGQGNILTKVGDGTTVGLLISKIGNIMTHVGDGMTIGVAKGKANIITKVGDGLGVNVAWGEANILTHV 1152 Moritella viscosa
WP_058589414 1052 THKGSSTTAAVLFGKGNILTKVGDGTTVGLLISDVGNIMTHVGDGTTVGFAKGKANIITKVGNGTGVNAVWGDANILTQV 1131 Photorhabdus laumo...

CEF32352     1158 GDGDRYNFAKGEANIITKIGDGQEVTVVQGQANIVTHVGNGDDYTGAWGKANVITKVGDGRNVVLAKGEANIVTQIGNGD 1237 Xenorhabdus nemato...
CAR44095     1075 GDGERYNFAKGNANIITKVGNGQETSVVKGNINIITHVGSGNNYTGAWGNGNVVTQIGDGRQVALAKGHANIVTMLGKGD 1154 Proteus mirabilis ...
WP_060388862 1130 GNGDRYSFAKGRANVLTKVGDGREVAVLQGEANLVTQVGNGDGYTGAWGKANVITKVGDGRQVVLAKGDANIVTQVGKGD 1209 Aeromonas hydrophila
ABX24512     1155 GDGDRYNFAKGEANVISKVGDGQEVSVVQGQANIITHVGDGDDYTGAWGKANVITKVGNGRNVVLAKGEANIVTQVGDGD 1234 Vibrio anguillarum
CSB02625     1152 GDGDRYNFAKGEANLITKVGDGQEVSVVQGEANIITHVGNGDDYTGAWGKANVITKVGHGQNVVLAKGEANIVTQVGDGD 1231 Vibrio cholerae
AHI58932     1153 GDGDRYNFAKGKANIITKVGNGQEVSVVHGDANIITHVGDGDDYTGAWGNANIITKVGDGRNVVFAKGKANIVTQVGDGD 1232 Moritella viscosa
WP_058589414 1132 GDGDRYNFAKGKANIITKVGNNQEITVVQGDANIITHVGQGDDYTGAWGKANVITKVGDGRNVVLAKADANIVTQVGNGD 1211 Photorhabdus laumo...

CEF32352     1238 SFNALWSQGNIVTKVGDGIQVTAAKGEGNITTTAGDGLNVTAVHGDLNINTKVGDGVSVNVAWGKLNVNTRVGDGLNVSV 1317 Xenorhabdus nemato...
CAR44095     1155 NYGIVWGKANISTKVGNGTQVTIAKGQANITTTVGDGLGVTVTYGNANINTKVGNGVSVNVAWGKYNVSTKVGDGLNVSV 1234 Proteus mirabilis ...
WP_060388862 1210 GYQALLGKANIVTRVGDGIQVTLAKGEVNQTTTVGDGLSVTAAYGKFNNNVKVGDGTTINLAWGDYNLNTKVGDGLNVAV 1289 Aeromonas hydrophila
ABX24512     1235 SFNALWSKGNIVTKVGDGMQVTAAKGKANVTTRVGDGLNVTAAYGDANINTVVGDGISVNVAWGQYNVNTKIGDGLNVAV 1314 Vibrio anguillarum
CSB02625     1232 SFNALWSKGNIVTKVGDGMQVTAAKGQANITTTVGNGLNVTAAYGDANINTKVGDGVSVNVAWGKYNINTKVGDGLNVAV 1311 Vibrio cholerae
AHI58932     1233 SFNALWSKGNIVTKVGDGMQVTAAKGKANIVTTIGNGLSVTATYGDLNINTKVGDGVSVNVAWGKYNVNTKVGDGLNVAV 1312 Moritella viscosa
WP_058589414 1212 SFNALWSRGNIVTKVGDGMQVTAAKGEANITTKVGNGLSVTATHGDFNINTNVGDGISINAAWGEYNVNTKVGQGLNVAI 1291 Photorhabdus laumo...

CEF32352     1318 MKGKGNANIRVGDGLNINASYARNNVAIQVGNGDFYSFAVAESNTESNKLDALFANIKQTLLGSAGSQGINYLVNGDE 1395 Xenorhabdus nematoph...
CAR44095     1235 MKGTANANIHVGNGLGINASYAKNNVIVKIGNGDIYSLSVASSNTQSNKLATFFGNIKQSVLGVVGSQAINYLVQGDD 1312 Proteus mirabilis HI...
WP_060388862 1290 MKGKGNANVQIGDGLDITAAYARHNVAIKIGNGDFYSLAIASSNTSSNKLGTLFDNIKQTLLGSAGNQAINYLVQGDE 1367 Aeromonas hydrophila
ABX24512     1315 MKGKANANIHVGDGLGVNASYAQNNVAIKIGNGDFYSLAVASSNTSSNKLSALFDNIKQTVLGVGGSQAINYLVQGDE 1392 Vibrio anguillarum
CSB02625     1312 MKGKANANIHVGDGLNINASYAQNNVAIKVGNGDFYSLAVASSNTSSNKLSALFDNIKQTVLGVGGSQAINYLVQGDE 1389 Vibrio cholerae
AHI58932     1313 MKGKANANIQVGDGLGINASYAQNNVAIKIGNGDFYSLSVASSNTESNKLSSLFDNIKQTILGMAGSQGINFLVQGDD 1390 Moritella viscosa
WP_058589414 1292 RKGKGNANIHIGDGLGINASYARNNLAIKVGNGDFYTLSIAESNTQSNNLPFLFKSIKRTVLSVEGSQAINYLIHGNE 1369 Photorhabdus laumondii

CEF32352     1396 .[3].SGTHKGRGAINLPEVSSLDGFKLTEIGEITSDLQNGLKGTVSGADEPNTD.[4].ALGNERRL.[2].NQ 1464 Xenorhabdus nematophila...
CAR44095     1313 .[3].SGSRKGKGAIHLIEKSSIDGFKMNKIDEVKSNIDINLKGHITEVETPSLS     DVNTDESN.[2].NN 1377 Proteus mirabilis HI4320
WP_060388862 1368      EGPLKAPQAASLGEVQGLSGFGLDEIGEVKSSLAGSLTGKVSQAGGRDEQ.[4].ALQLDEQG.[2].RG 1433 Aeromonas hydrophila
ABX24512     1393 .[3].SGTHKGRGAIATPEITKLDGFQMEAIEEVGSDLGDSLTGSVTKVDTPDLN.[4].ALDVDGSS.[2].TQ 1461 Vibrio anguillarum
CSB02625     1390 .[3].SGTHKGRGAIATPEITKLDGFQMDAIKEVSSDLGDSLTGSVTKVDTPDLN.[4].ALNVDDSS     VQ 1456 Vibrio cholerae
AHI58932     1391 .[3].SGFRRGRGAIATPEITKLNGFQMEEIAKIGSNLGNSMSGSVTDVETPDVA.[4].ELAIDEDV.[2].TE 1459 Moritella viscosa
WP_058589414 1370 .[3].SGTYRSRGAINLTEVSAIDGFQMNAIDDVGSDLRDKLSGTVTQVEIPDTE.[4].ALHIGDKV.[2].TQ 1438 Photorhabdus laumondii

CEF32352     1465 .[141].SE.[3].SHLAEHVKQDKAAQNALQDKAQAEADRQRLEQEKDNQLAAISGTQKQLENTDLNALNANGQSQRDA 1676 Xenorhabdus nemato...
CAR44095     1378 .[163].SA.[1].ANINKHISDSDATKNALADKKKADANRQKLTDEKQRLLDHISTTQTELESTDHLALEKNGHRERDA 1609 Proteus mirabilis ...
WP_060388862 1434 .[142].AS.[5].GQVSAQLAQDDNAARARGDQASADADKQRLEQEKGQQLAAIAGTQAQLEATDQHKLAQNGQDQRAA 1648 Aeromonas hydrophila
ABX24512     1462 .[141].SE.[5].NAVSEHATQNQASQNALSDKERAEADRQRLEQEKQKQLDAVAGSQSQLESTDQQALGNNGQAQRDA 1675 Vibrio anguillarum
CSB02625     1457 .[141].SE.[5].NAIREHATQNPAAQNALSDKERAEADRQRLEQEKQKQLDAVAGSQSQLESTDQQALENNGQAQRDA 1670 Vibrio cholerae
AHI58932     1460 .[141].SE.[4].DAVSKHAEQNKATQNATADKERAEADSQRLKQEKAQQLAAISGSQSKLEATDQSALETNGQAEREA 1672 Moritella viscosa
WP_058589414 1439        SE.[5].DAVIKQAKQDSAEQNALNDKEKAEENYRILEQERDNQLKEISKSQFQLESTDQNVLNTNGQVQRDA 1511 Photorhabdus laumo...

CEF32352     1677 IDGEARAFTDELKEKVKGLDALDSYATYDGKSGEQWH     QFADGLKGRIQTQLDSTNKKVKKQLTDSQQAITGRLND 1751 Xenorhabdus nemato...
CAR44095     1610 ILEEANSVTHNLTTVGQTLEVLSEYSQDAPPSDQPWS.[1].PFAEGILKDVQKSLINTKKIVSVPVNNIKTQYVANLTK 1685 Proteus mirabilis ...
WP_060388862 1649 IEAESREMTVQLDTLARRFEQVRASDVASEPSGQHWR.[1].GFADRLLSTVQEDLDDAGNTAGTAIEEARSRHEAQHQQ 1724 Aeromonas hydrophila
ABX24512     1676 VQEESEAITAELTKLAQGLDVLDSQATHTGESGDQWR.[1].NFAGGLLDGVQTQLDNAKQVSGEQIAAAKQTHADNQNK 1751 Vibrio anguillarum
CSB02625     1671 VKEESEAVTAELAKLAQGLDVLDGQATHTGESGDQWR.[1].DFAGGLLDGVQSQLDDAKQLANDKIAAAKQTLSDNNSK 1746 Vibrio cholerae
AHI58932     1673 LVAEQEDITKELTDMTKGLDALDGQANYQGESGERWR.[1].HFAGGILDNVQSKLDDAKSHSNEQLEKAAQKNKQNQLN 1748 Moritella viscosa
WP_058589414 1512 ISGESRAVTKELLSMTQRLNALNDDGNYAGELGDEWR.[1].RFAVGYLDRIQEKLDDTKLISQKKLADLSPRFIDNQQQ 1587 Photorhabdus laumo...

CEF32352     1752 IKDAVAKSEAGVINGEKNQLNAEKGIDKARAEAKFREQEATRQQQRAEQAKHDGNLAAQKAEQRGQQEVFAANNKTAQVQ 1831 Xenorhabdus nemato...
CAR44095     1686 VKKSIKKSEYGVIQSEEHCQEVQLDTSKAKNDADKRYSDAIDKKNSAQMAEKKASTMVEDARSRGDTEQKTATSISDKAQ 1765 Proteus mirabilis ...
WP_060388862 1725 LDNALAKSKTGQQRSEQLQGDAEAAGQQRAAQAEQRRLDALARQGEATSRQQQGEASASQAQLAGEQAASQAGLQANQAK 1804 Aeromonas hydrophila
ABX24512     1752 VKDSVEQSEAGVAKGEQNLAGAEQDIDDARTDAEKRKDDALAKGNDAKQAESDAHSAANDAQSRGDRDAMNAENKANQVQ 1831 Vibrio anguillarum
CSB02625     1747 VKESVAKSEAGVAQGEQNRAGVEQDIADAQADAEKRKADALAKGKDAQQAESDAHHAVNNAQSRGDRDVQLAENKANQAQ 1826 Vibrio cholerae
AHI58932     1749 VQDAVAKSEAGVAKGERKKSQCTTRYDDAKTKANLRKDEALVKEQEAQQAATKANADSNKAQKRGEQDSAAAQNKSSQAQ 1828 Moritella viscosa
WP_058589414 1588 VKNAVGKSETGLEQSYHNIKNADDNIEDAHTKAKSRQKEADLQRLRATKAESDAYAVYEEAKQRGEHDSSVAKNKAAQVQ 1667 Photorhabdus laumo...

CEF32352     1832 SNAQGSKLD.[1].NYKPNRAGAAG     SGLSGK.[6].NVSLESDA.[1].SG.[1].DPNVELPAQTNA.[2].SA 1892 Xenorhabdus nemato...
CAR44095     1766 KEAKSVQLK.[1].SDKPNRHRAHG     SGLSGE     AAYVEGAD.[2].PS.[1].YIKPISTKKNDG.[2].NN 1821 Proteus mirabilis ...
WP_060388862 1805 QNAASLKQS     GDKPTRQGVQS.[2].STAAGQ.[6].ELDVPAVG     TL.[1].APDEVPPSAIDT     AT 1863 Aeromonas hydrophila
ABX24512     1832 NDAKGAKQN.[1].SDRPDRQGVAG     SGLAGQ     AHSVEAAG.[1].AG     HINADSQANADG.[2].SE 1885 Vibrio anguillarum
CSB02625     1827 ADAQGAKQN.[1].GDRPDRQGVTG     SGLSGN     AHSVEGAG.[1].TD.[1].HVNTDSQTNADG.[2].SE 1881 Vibrio cholerae
AHI58932     1829 ADAKAAKQD.[1].DETPNRDGASG     SGLSGK     AYEAQEVA.[1].ST.[1].HVDADFEVAADG.[2].SE 1883 Moritella viscosa
WP_058589414 1668 ADAKGAKQT.[1].DVKPERSGATG     SGLSGK     AYTPIDVA.[1].PK.[1].HINPEAKMEANG.[2].SE 1722 Photorhabdus laumo...

CEF32352     1893 ELQ.[2].DEDLNELSNAKEALNRLQINAGVR 1921 Xenorhabdus nematophila str. Websteri
CAR44095     1822 KLT     TFNQELLDDAQQAINRLSINAGIR 1848 Proteus mirabilis HI4320
WP_060388862 1864 GLS     EQEQSALDGALAAVNRLQINAGSR 1890 Aeromonas hydrophila
ABX24512     1886 GLS     EQELEALEGATNAVNRLQINAGIR 1912 Vibrio anguillarum
CSB02625     1882 GLT     EQEQEALEGATNAVNRLQINAGIR 1908 Vibrio cholerae
AHI58932     1884 GLT     EQEQKAIEGATLAVNRLTINARSH 1910 Moritella viscosa
WP_058589414 1723 DLT.[2].AADLAGLNSAQRAINRLQINRSSR 1751 Photorhabdus laumondii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap