Conserved Protein Domain Family
COG5022

?
COG5022: COG5022 
Myosin heavy chain [General function prediction only]
Statistics
?
PSSM-Id: 227355
View PSSM: COG5022
Aligned: 12 rows
Threshold Bit Score: 1184.49
Threshold Setting Gi: 19173319
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

15214090   17 .[72].DMVDDMAALTCLNEPSVVNNLTQRYEKDLIYTYSGLFLVAVNPYCHLP     IYGDDVVRKYQSKQ.[ 4].K 155  fission yeast
19074177   23 .[81].DMVDDLAELSYLNEPGVLHNLRRRYQNGRIYTYSGLFLLAINPYKDLR     IYGEKDARKYTLSK.[ 4].E 170  Encephalitozoon cuniculi
19173319    1       MENDDLCELSNLNENAVVDILEKRYASGKIYTKSGLVFLALNPYENIG     SCGGETMQSCSSYS      H 63   Encephalitozoon cuniculi
19112194    1 .[39].VGVDDLTLLSKITDEEINKNLELRFRNGEIYTYIGHVLISVNPFRDLG     IYTMDILKSYQGKN.[ 4].S 106  fission yeast
19113025    1 .[64].ESPSDLTNLPYLNEPSVLHALHNRYNNKQIYTYSGIVLVSINPYQNLP.[1].FYNDNLIKHFHKDP.[ 4].V 132  fission yeast
19075992    1 .[72].SDADDLTDLSYLNEPSVLDALSTRYNQLQIYTYSGIVLIAVNPFQRLP.[1].LYTHEIVRAYSEKS.[ 4].D 140  fission yeast
12643253    6 .[71].DRVNDMAELTYLNEPAVTYNLEQRYLSDQIYTYSGLFLVAVNPYCGLP     IYTKDIIQLYKDKT.[ 4].L 143  fission yeast
417335      1 .[70].ESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVD.[1].LYSREMIQNYSSKR.[ 4].E 138  baker's yeast
730092      2 .[73].DKVENMSELTHLNEPSVLYNLEKRYDCDLIYTYSGLFLVAINPYHNLN     LYSEDHINLYHNKH.[16].P 153  baker's yeast
6322720     1 .[35].VGISDLTLLSKISDESINENLKKRFKNGIIYTYIGHVLISVNPFRDLG     IYTNAVLESYKGKN.[ 4].P 102  baker's yeast
2498024     1 .[35].VGVSDLTLLSKISDEAINENLKKRFLNATIYTYIGHVLISVNPFRDLG     IYTDAVMNEYKGKN.[ 4].P 102  baker's yeast
127736      1 .[69].EATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVD.[1].LYTQDMIQAYAGKR.[ 4].E 137  baker's yeast

15214090  156 PHIFGTADAAYRSLLERR.[1].NQSILVTGESGAGKTETTKKVIQYLTSVTDAS.[ 5].QLEKKILETNPVLEAFGNA 230  fission yeast
19074177  171 PHIFAVANEAYRLMLSNR.[1].NQSILITGESGAGKTENTKRVVEFLAMVGGCK.[ 4].SIDRQIIDANPILEAFGNA 244  Encephalitozoon cuniculi
19173319   64 PHVYDVAEASHQDLLVHG     NQTIVISGESGSGKTENAKLVIKYLLEGTASS.[ 1].SIEKGITAANTILEAFGNA 133  Encephalitozoon cuniculi
19112194  107 PHVYAIAENAYYQMKSYH.[1].NQCIIISGESGAGKTEAAKRIMQYITHVSKSV.[ 5].RVSEIILATNPLLESFGCA 181  fission yeast
19113025  133 PHLYSIASSCYHALTTDS.[1].NQTIIVSGESGAGKTVAAKYIMRYLTSVQGVD.[ 7].SVENQVLATNPIMEAFGNA 209  fission yeast
19075992  141 PHLYAIAEDSYKCMNQEH.[1].NQTIIISGESGAGKTVSARYIMRYFASVQALI.[14].AVENEILATNPIMEAFGNS 224  fission yeast
12643253  144 PHVFAIADLAYNNLLENK.[1].NQSILVTGESGAGKTENTKRIIQYLAAIASST.[ 5].QVEEQIIKTNPVLESFGNA 218  fission yeast
417335    139 PHLFAIAEEAYRFMVHEK.[1].NQTVVVSGESGAGKTVSAKYIMRYFASVQESN.[ 9].QIESQILATNPIMEAFGNA 217  baker's yeast
730092    154 PHIFAIAEEAYENLLSEG.[1].DQSILVTGESGAGKTENTKKILQYLASITSGS.[14].SFEMKILQSNPILESFGNA 237  baker's yeast
6322720   103 PHVFAIAESMYYNLKSYN.[1].NQCVIISGESGAGKTEAAKRIMQYIAAASNSH.[ 5].KIKDMVLATNPLLESFGCA 177  baker's yeast
2498024   103 PHVFAIAESMYYNMKSYN.[1].NQCVIISGESGAGKTEAAKRIMQYIAAASSTH.[ 5].KIKDMVLATNPLLESFGCA 177  baker's yeast
127736    138 PHLFAIAEEAYRLMKNDK.[1].NQTIVVSGESGAGKTVSAKYIMRYFASVEEEN.[11].ETEQKILATNPIMEAFGNA 218  baker's yeast

15214090  231 QTVRNNNSSRFGKFIRIEFS.[2].GSIVGANLDWYLLEKSRVIHPSSNERNYHVFYQLLRG.[8].LFL.[1].RYVDH 306  fission yeast
19074177  245 QTVKNDNSSRFGKFIKIKFN.[1].GNICGAHIEKYLLEKSRVTSQNRNERNYHIFYQLLGC.[7].QLF.[2].GEPKD 319  Encephalitozoon cuniculi
19173319  134 QTALNDNSSRFGKRIKLMFD     GKITGAKFETYLLEKSRVTHHELGEKNFHIFYQFCAS     KGL     SLKND 198  Encephalitozoon cuniculi
19112194  182 KTLRNNNSSRHGKYLEMIFN.[2].GVPVGAKITNYLLEKNRIVNQVRNERNFHIFYQFTKS.[7].TYG.[1].QGPEN 256  fission yeast
19113025  210 KTIRNDNSSRFGKYVTISFD.[2].LLITGANVNTYLLERSRVVSLLKGERNYHIFYQLITG.[7].KWF.[1].ESASS 284  fission yeast
19075992  225 KTSRNDNSSRFGKYIQILFD.[2].ATIIGAKIQTYLLERSRLVFQPNQERNYHIFYQILAG.[8].WKL.[1].ENSQE 300  fission yeast
12643253  219 RTVRNNNSSRFGKFIKVEFS.[2].GEISNAAIEWYLLEKSRVVHQNEFERNYHVFYQLLSG.[8].LLL.[1].DNCND 294  fission yeast
417335    218 KTTRNDNSSRFGKYLQILFD.[2].TTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEG.[7].ELH.[1].SSPKD 292  baker's yeast
730092    238 QTVRNNNSSRFGKFIKIEFN.[2].GMINGAHIEWYLLEKSRIVHQNSKERNYHIFYQLLSG.[8].LRL.[2].RNVKD 314  baker's yeast
6322720   178 KTLRNNNSSRHGKYLEIKFN.[2].FEPCAGNITNYLLEKQRVVGQIKNERNFHIFYQFTKG.[7].MFG.[1].QMPEQ 252  baker's yeast
2498024   178 KTLRNNNSSRHGKYLEIKFN.[2].FEPCAGNITNYLLEKQRVVSQIKNERNFHIFYQFTKG.[7].TFG.[1].QKPEQ 252  baker's yeast
127736    219 KTTRNDNSSRFGKYLEILFD.[2].TSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAG.[7].ELH.[1].TDASD 293  baker's yeast

15214090  307 YSYLKNG     LKHINGVDD.[1].KEFQKLCFGLRTLGFDN.[2].IHSLFLIIASILHIGNIEVAS.[2].SGQARF 371  fission yeast
19074177  320 YRFLKDS     RFKIPDVDD.[1].KEFRSLRESMRVLGIGE.[2].QIGYFKIVSAILHLGNIEFRE.[1].DGAAEI 383  Encephalitozoon cuniculi
19173319  199 FIDTSSL.[1].GNKEGLIRL.[1].EEYETTCSAMKSIGICS     LKAIEDCLLGILYLGSIQFNS     DGILKA 260  Encephalitozoon cuniculi
19112194  257 YVYTSAC.[1].CLSVDGISD.[1].KDFQGTMNAMKVIGITE.[2].QDEIFRMLSIILWLGNIQFQE.[2].DGGSVI 322  fission yeast
19113025  285 FNYLSQG.[1].CDEISGVDD.[1].NDFTITCRALSTIGISE.[2].QEDVFCLLAALLHLGNIEVCA.[2].NEAQIQ 350  fission yeast
19075992  301 FNYLKQG.[1].CSTIEGVND.[1].EEFKATVDALKTVGIDN.[2].CECIFSLLAALLHIGNIEVKH.[2].NDAYID 366  fission yeast
12643253  295 YRYLKDS     VHIIDGVDD.[1].EEFKTLLAAFKTLGFDD.[2].NFDLFNILSIILHMGNIDVGA.[2].SGIARL 359  fission yeast
417335    293 YHYTNQG.[1].QPNIAGIDE.[1].REYKITTDALSLVGINH.[2].QLGIFKILAGLLHIGNIEMKM.[2].NDASLS 358  baker's yeast
730092    315 YKILSNS.[1].QDIIPGIND.[1].ENFKELLSALNIIGFSK.[2].IRWIFQVVAIILLIGNIEFVS.[2].AEQASF 380  baker's yeast
6322720   253 YIYTAAA.[1].CTSADQLMR     KDYEGTLEAMRTIGLVQ.[2].QDQIFRMLAAILWIGNISFIE.[2].EGNAQV 317  baker's yeast
2498024   253 YVYTAAA.[1].CISAETIDD.[1].QDYQETLKAMRVIGLGQ.[2].QDQIFRMLAAILWIGNVSFIE.[2].EGNAQV 318  baker's yeast
127736    294 YFYMNQG.[1].DTKINGIDD.[1].KEYKITVDALTLVGITK.[2].QHQIFKILAALLHIGNIEIKK.[2].NDASLS 359  baker's yeast

15214090  372 PS.[2].QIDQLCHLLEIPVDGFVNAALHPKSKA.[1].REWIVTARTREQVVHTLQSLAKGLYERNFAHLVKRLNQTMY 444  fission yeast
19074177  384 AN.[2].VAEKACKLLSIPLAEFIKRLIHPVIKA.[1].NEYVAHSRSREQALKIVDGLSRILYDKMFEGVIDRINMSLD 456  Encephalitozoon cuniculi
19173319  261 VR.[2].YFTEFCKLHGIQEDTFEESLVKFSIQV.[1].GETIEVFNTLKQAITIRNSMARLLYSNVFNYITASINNCLG 333  Encephalitozoon cuniculi
19112194  323 SD.[2].ITEFLGYLIGVPVAAIERALTIRIMQT.[6].GSVYEVPLNPTQALAVRDALSMAIYNCLFDWIVERVNKALV 400  fission yeast
19113025  351 PG.[2].YLQKAALLLGVDSSTLAKWIVKRQLKT.[1].SETIITSSTLEHAISIRDSVAKYLYSALFLWIVHMINASLD 423  fission yeast
19075992  367 SK.[2].NLINATSLLGVDPSSLVKWLTKRKIKM.[1].SEGILKPLNEFQAVVARDSVAKFLYASLFDWLVATINKALM 439  fission yeast
12643253  360 LN.[2].EIDKLCHLLGVSPELFSQNLVRPRIKA.[1].HEWVISARSQTQVISSIEALAKAIYERNFGWLVKRLNTSLN 432  fission yeast
417335    359 SE.[2].NLQIACELLGIDPFNFAKWIVKKQIVT.[1].SEKIVTNLNYNQALIARDSVAKFIYSTLFDWLVDNINKTLY 431  baker's yeast
730092    381 KN     DVSAICSNLGVDEKDFQTAILRPRSKA.[1].KEWVSQSKNSQQAKFILNALSRNLYERLFGYIVDMINKNLD 451  baker's yeast
6322720   318 GD.[2].VTDFVAYLLQVDASLLVKCLVERIMQT.[6].GSVYHVPLNPVQATAVRDALAKAIYNNLFDWIVDRVNVSLQ 395  baker's yeast
2498024   319 RD.[2].VTDFVAYLLQIDSQLLIKSLVERIMET.[6].GSVYHVPLNIVQADAVRDALAKAIYNNLFDWIVSRVNKSLQ 396  baker's yeast
127736    360 AD.[2].NLKLACELLGIDAYNFAKWVTKKQIIT.[1].SEKIVSNLNYSQALVAKDSVAKFIYSALFDWLVENINTVLC 432  baker's yeast

15214090  445 YSQS.[3].GFIGVLDIAGFEIFTFNSFEQLCINFTNEKLQQFFNHYMFVLEQEEYTQERIEWDFIDY.[1].NDLQPTI 518  fission yeast
19074177  457 SPHK.[1].NFIGVLDIAGFEIFEKNSFEQLCINYTNEKLQQFFNHHMFILEQEVYRQENIEWDFIDF.[1].LDLQPTI 528  Encephalitozoon cuniculi
19173319  334 GSGE     HSISVLDIFGFEIFESNGLDQLCINWTNEKIQNDFIKKIFRDKQKMYKEEGIEWSDVEC     FDNNQCI 403  Encephalitozoon cuniculi
19112194  401 TSDN.[3].NSIGILDIYGFEIFENNSFEQLCINYVNEKLQQIFIELTLKTEQEEYVREQIAWTPIKY     FNNKVVC 473  fission yeast
19113025  424 HNKV.[5].KYIGVVDIYGFEHFEKNSMEQFCINYANEKLQQEFNKHVFKLEQEEYVKEGLDWRLIEY     SDNQGCI 498  fission yeast
19075992  440 YSAD.[7].SFIGVLDIYGFEHFKKNSFEQFCINYANEKLQQEFYRHVFKLEQEEYAAEGLNWSYIDY     QDNQQCI 516  fission yeast
12643253  433 HSNA.[2].YFIGILDIAGFEIFEKNSFEQLCINYTNEKLQQFFNHHMFVLEQEEYMKEEIVWDFIDF.[1].HDLQPTI 505  fission yeast
417335    432 DPEL.[7].SFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEF     SDNQPCI 508  baker's yeast
730092    452 HGSA.[2].NYIGLLDIAGFEIFENNSFEQLCINYTNEKLQQFFNNHMFVLEQSEYLKENIQWDYIDY.[1].KDLQLTI 524  baker's yeast
6322720   396 AFPG.[2].KSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKAEQETYEREKIKWTPIKY     FDNKVVC 467  baker's yeast
2498024   397 AFPG.[2].KSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQETYEREKIQWTPIKY     FDNKVVC 468  baker's yeast
127736    433 NPAV.[5].SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEF     NDNQPCI 507  baker's yeast

15214090  519 DAIEK.[2].PIGIFSCLDEDCVMPMATDATFTEKLHLLFK.[2].SDIYR.[3].FSS.[1].GFVLKHYAGDVEYDTK 586  fission yeast
19074177  529 DLIEK.[2].PIGILSYLDEECVMPMATEKTFLGKLMKNIR     DEKFE.[3].IRD     AFVLNHYAGDVEYTVD 593  Encephalitozoon cuniculi
19173319  404 LDFEK     PCGLMDLISEESFNAWGNVKNLSVKIKNYLN     GRIRT     KAG.[1].KIVVSHYAGDVEYDLR 464  Encephalitozoon cuniculi
19112194  474 DLIES.[2].PPGLFAAMNDAIATAHADSAAADSAFAQRLN.[4].NPHFE     QRQ.[1].QFIVKHYAGDVTYSIT 540  fission yeast
19113025  499 SLIED     KLGILSLLDEECRLPSGNHQSFLQKLNNQLP.[3].SQFYK.[3].FND.[1].SFMVKHYALDVSYQVH 565  fission yeast
19075992  517 SMIES     RLGILSLLDEECRMPTNSDENWVSKLNDAFS.[4].KNSYQ.[3].FGN.[1].EFTIKHYALDVVYCAE 584  fission yeast
12643253  506 DLIEK.[2].PIGILSCLDEECVMPKATDATFTSKLDALWR.[2].SLKYK.[3].FAD.[1].GFILTHYAADVPYSTE 573  fission yeast
417335    509 DLIEN     KLGILSLLDEESRLPSGSDESWASKLYSAFN.[4].NEVFS.[3].FGQ.[1].KFIVSHYAVDVEYEVE 576  baker's yeast
730092    525 DLIES.[3].PTGVLPLLDEEAVLPKSTDESFYSKLISTWD.[2].SSKFK.[3].LKN     GFILKHYAGDVEYTVE 592  baker's yeast
6322720   468 DLIEA.[2].PPGILAAMNDSIATAHADSNAADQAFAQRLN.[4].NPYFE     LRA.[1].KFVIKHYAGDVTYDIN 534  baker's yeast
2498024   469 DLIEA.[2].PPGIFAAMNDSVATAHADSNAADQAFAQRLN.[4].NPHFD     LRS.[1].KFVIKHYAGDVTYDID 535  baker's yeast
127736    508 DLIEN     KLGILSLLDEESRLPAGSDESWTQKLYQTLD.[4].NKVFS.[3].FGQ.[1].KFIVSHYALDVAYDVE 575  baker's yeast

15214090  587 DWLEKNKDPLNACLAALMFKSTNSHVSSLFD.[23].RHRRQLSSLMHQLEATQPHFVRCIIPNNLKQPHNLDKSLVLHQ 683  fission yeast
19074177  594 DWLSKNKDSHSEALTSLIRASGSELVSRLSL.[15].KHKEQLASLMSELRRTNPHFVRCIIPNLEKSGEHLDNGIVLGQ 682  Encephalitozoon cuniculi
19173319  465 SFLDKNREKGNLRIFKNPLIADEESKEDLVK      YFKDSMNKLLSSINETQAKYIKCIRPNSHRRPRIFDRQLVSKQ 538  Encephalitozoon cuniculi
19112194  541 GMTDKNKDQLATDILNLIHSSNNEFMKSIFP.[16].RIKTSANDLVETLMKCQPSYIRTIKPNQTKSPNDYDQQMVLHQ 630  fission yeast
19113025  566 DFLAKNSDAIPDEFISLLQNSKNEFITYLLD.[26].MFKSSLSQLMTTVSSTNVHYIRCIKPNEEKLPWTFSPPMVLSQ 665  fission yeast
19075992  585 GFIDKNRDTISDELLELFTNSDVPFVKDLVL.[26].MFKSSLVSLMSTINETNAHYIRCIKPNEEKEAWKFDNQMVVSQ 684  fission yeast
12643253  574 GWLEKNTDPLNENVAKLLAQSTNKHVATLFS.[24].RHKEQLNQLMNQFNSTQPHFIRCIVPNEEKKMHTFNRPLVLGQ 671  fission yeast
417335    577 GFIEKNRDSVSLGHLDVFKATTNPIFKQILD.[34].MFKKSLGELMAIINSTNVHYIRCIKPNSEKKPWEFDNLMVLSQ 684  baker's yeast
730092    593 GWLSKNKDPLNDNLLSLLSSSQNDIISKLFQ.[34].RHREQQITLLNQLASTHPHFVRCIIPNNVKKVKTFNRRLILDQ 700  baker's yeast
6322720   535 GITDKNKDQLQKDLIELIGTTTNTFLSTIFP.[16].KIIKSANELVETLSKAEPSYIRTIKPNQTKSPNDYDDHQVLHQ 624  baker's yeast
2498024   536 GITDKNKDQLQKDLVELIGTTTNTFLATIFP.[16].KIIKSANDLVETLSKAQPSYIRTIKPNETKSPNDYDDRQVLHQ 625  baker's yeast
127736    576 GFIEKNRDTVSDGHLEVLKASTNETLINILE.[39].MFKQSLIELMNTINSTNVHYIRCIKPNADKEAWQFDNLMVLSQ 688  baker's yeast

15214090  684 LRCNGVLEGIRIAQTGFPNKLFYTEFRARYGILSQ.[16].INE.[3].PS.[2].YRLG.[1].TKVFFKAS     VL 759  fission yeast
19074177  683 LKCNGVLEGIRISRQGFPSRMGHREFVQRYRIMMK.[25].LSE.[3].ST.[2].YRLG.[1].TKVFFRQG     VL 767  Encephalitozoon cuniculi
19173319  539 LAECGILETIRISKQCFPQEIAKDEFESRYRILGP      TLF.[3].SI     EKGE     TRYFMNNE     SL 595  Encephalitozoon cuniculi
19112194  631 IKYLGLQENIRIRRAGFAYRQAFDTFAQRFAVLSG.[21].LKD.[3].PS.[2].YQMG.[1].SKVFIKNP.[1].TL 712  fission yeast
19113025  666 LRACGVFETIRISSLGFPARFSYEEFAHRFRILLS.[19].IPH     DN.[2].FQVG.[1].SKIFFRSN     VI 741  fission yeast
19075992  685 LRACGVLETIKISCAGFPSRWTFDEFVSRYYMLVP.[15].LEK.[2].DP.[2].YQIG.[1].TKIFFRSG     VT 758  fission yeast
12643253  672 LRCNGVLEGIRITRAGFPNRLPFNDFRVRYEIMAH.[16].LEE.[3].DE.[2].YRIG.[1].SKIFFKAG     VL 747  fission yeast
417335    685 LRACGVLETIRISCAGFPSRWTFDEFVQRYFLLTD.[25].LDA.[3].DS.[2].YQIG.[1].TKIFFKAG     ML 769  baker's yeast
730092    701 LRCNGVLEGIRLAREGYPNRIAFQEFFQRYRILYP.[23].LTS.[3].DT.[2].YKIG.[1].TKLFFKAG     VL 783  baker's yeast
6322720   625 VKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSP.[21].LRD.[3].PE.[2].FQLG.[1].TSVFIKTP.[1].SL 706  baker's yeast
2498024   626 IKYLGLQENVRIRRAGFAYRQVFEKFVERFYLLSP.[21].LQD.[3].PQ.[2].YQLG.[1].TSVFIKTP.[1].TL 707  baker's yeast
127736    689 LRACGVLETIRISCAGFPSRWTFEEFVLRYYILIP.[25].LDA.[3].DK.[2].YQIG.[1].TKIFFKAG     ML 773  baker's yeast

15214090  760 GSLEDRRNALLRVIFNSFSARIR.[1].FLTRRRLYRFNHRQDAAILLQHNLRQL     KLLKPHPWWNLFLHLKPLLG 830  fission yeast
19074177  768 ADIEDMRDVKVSEVVKEIQALIR.[1].RLAFRKYNQAQRRMQGILVIQRNGRIC     CDLQRWNWWRLYLKIKPLLD 838  Encephalitozoon cuniculi
19173319  596 KILEMRRLMFYDECFRNIRRALR     SYLDGRVLSKKQSITFVTKPMDSGPAL.[1].DNSSMELPIQRDFSTEESHS 666  Encephalitozoon cuniculi
19112194  713 FALEDMRDKFWDTMATRIQRAWR     SYVRRRSEAAACIQKLWNRNKVNMELE     RVRNEGTKLLQGKKQRRRYS 782  fission yeast
19113025  742 GNFEEAHRATCSKSTVLLQSAIR.[1].FFTRKEYQRTVKFIIKLQSVIMGWLTR     QRFEREKIERAAILIQAHWR 812  fission yeast
19075992  759 PLLESARDKALKHAAHLLYEAFA.[1].NYYRTRFLLSRKRVRSFQAVAHGFLSR     RHTEYELLSSNIIKLQSLWR 829  fission yeast
12643253  748 AELEERRVATLQRLMTMLQTRIR.[1].FLQRKIFQKRLKDIQAIKLLQANLQVY     NEFRTFPWAKLFFNLRPLLS 818  fission yeast
417335    770 AFLEKLRTNKMNEICIIIQKKIR.[1].RYYRLQYLQTMESIKKCQSQIRSLLVR     TRVDHELKTRAAILLQTNIR 840  baker's yeast
730092    784 ADLEKQKDVKLNNIMIKLTATIR.[1].YTVRKEITYHLQKLKKTRVIGNTFRLY.[1].RLVKEDPWFNLFIRIKPLLT 855  baker's yeast
6322720   707 FALEDMRDKYWYNMAARIQRAWR     RFLQRRIDAAIKIQRTIREKKGGNKYV     KLRDYGTKLLAGKKERRSMS 776  baker's yeast
2498024   708 FALEHMRDRYWHNMAARIQRAWR     RFLQRRIDAATKIQRTIRERKEGNKYE     KLRDYGTKVLGGRKERRSMS 777  baker's yeast
127736    774 AYLEKLRSNKMHNSIVMIQKKIR.[1].KYYRKQYLQISQAIKYLQNNIKGFIIR     QRVNDEMKVNCATLLQAAYR 844  baker's yeast

15214090  831 TTQTDEYLRRKDALINNLQ.[13].TITKERVLQL.[ 7].QALAHEKDILVERA.[1].SRVEVVHERLSSLE.[ 5]. 913  fission yeast
19074177  839 VRKRDGEMKEKEAMIQEYA.[ 1].MLDAEKSRRE.[ 1].VEDMLKAMSLKREL.[1].EKSVEDEKRFSMEK.[11]. 909  Encephalitozoon cuniculi
19173319  667 LAESREEQRSYAEIIRDLE.[ 1].KIEQYKKFCE.[ 1].PCRNCRSLELKYRF.[1].SEALKKKNMVELEL       726  Encephalitozoon cuniculi
19112194  783 ILGSRKFYGDYLSASKPNG      TLWNTCGLSQ.[ 3].VIFSMRCEVLVHKL     GRTSKPSPRQLVLT.[ 5]. 847  fission yeast
19113025  813 SYIQRKRYLSLIKCAIVIQ      SIVRKNIAYS.[ 3].NELRESSATLLAKF     WRAYNARKTFRGLK.[ 5]. 877  fission yeast
19075992  830 TALKRKEFIQTKNSILKVQ      SIIRGFLLRQ.[ 3].EKTKHDATLIIQSL     WLTFKAHKHYKELQ.[ 5]. 894  fission yeast
12643253  819 STQNDKQLKKRDAEIIELK.[ 1].ELKKQQNSKS.[ 1].VERDLVETNNSLTA     VENLLTTERAIALD.[ 5]. 882  fission yeast
417335    841 ALWKREYYRAAIGQIIKLQ.[ 1].TCKRKLILDS.[ 2].RKFMLMAAVIIQSY     IRSYGHKTDYRTLK.[ 5]. 905  baker's yeast
730092    856 SSNDMTRTKKFNEQINKLK.[13].EEKNQKTVNE.[11].KENLRKNESLLNRV.[1].TSSETLQKQFDDLV.[10]. 947  baker's yeast
6322720   777 LLGYRAFMGDYLSCNESKT.[ 1].GSYIRRQVGI.[ 3].VVFSIKGECLHSKF     GRSAQRLKKVFILT.[ 5]. 842  baker's yeast
2498024   778 LLGYRAFMGDYLSCNESKS.[ 1].GAYIKRQVSI.[ 3].VIFSIHGEALHTKF     GRSAQRLKKTFLLT.[ 5]. 843  baker's yeast
127736    845 GHSIRANVFSVLRTITNLQ.[ 1].KIRKELKQRQ.[ 2].QEHEYNAAVTIQSK     VRTFEPRSRFLRTK.[ 5]. 909  baker's yeast

15214090  914 ADEKYEFLYAEKQSIEEDLANK.[2].EISYLSDLSSTLEKKLSSIKK.[17].NIMADYQHS.[1].QHLSNLEKAINE 997  fission yeast
19074177  910 DETAQELEKARKEVFDGHEERK.[4].RVNEVAIQLEEKDSEILRLRR.[17].SLREEVVSK.[2].EKDAMVEKMLRE 996  Encephalitozoon cuniculi
19173319  727 EKYKAKVEDLERRLSEKDDDDS.[4].SFTNSYNVFSCLVQLYLEFVP.[ 4].DEVPKSEIL.[2].AHSAFYAVNKLG 800  Encephalitozoon cuniculi
19112194  848 LVITKIVDQKLTQQVEKKFAVS     SIDSVGLTNLQDDWVAIRNKS.[ 4].DMFLRCFFK.[1].EFITTLKRINRN 916  fission yeast
19113025  878 LQCVSRSVLTRRYLRRLQDSAG     RTSILYEKQKNLQASITEVSK.[10].VLRNKLNIL.[1].NSLSKWKCLIKK 952  fission yeast
19075992  895 IQSLWRMKLAKRQLTELKIEST     KASHLKQVSYRLESRLFEISK.[ 4].SEQENNKFR     ERIAELESHLSN 962  fission yeast
12643253  883 RRTQERLANIEDSFSETKQQNE.[4].ESASLKQINNELESELLEKTS.[ 4].LLSEQNELK.[1].KLSLEEKDLLDT 955  fission yeast
417335    906 VQSAMRMQLARRRYIVLQKEVE     ERNIRASYGIGLLEEAIEFKN      SFILNLEML.[1].DSYTRLTQLLQG 970  baker's yeast
730092    948 LEVAQNLEEAHQKIQGLQETIR.[4].TLEKLHSKNNELIKQISDLNC.[ 9].SLIKESKLK.[2].NEIKRLKDVINS 1026 baker's yeast
6322720   843 IIGQTREQNAMKYTQDYKIDVG     KIKQVSLTNLQDDWMGVILVN.[ 4].DPLINTPFK.[1].ELMTRLKKLNEK 911  baker's yeast
2498024   844 IVGQTLVQNAMTYTQDYKIDVR     NIQAVSLTNLQDDWVAIKLAS.[ 4].DPLINTYFK.[1].ELITHLKRLNDK 912  baker's yeast
127736    910 VQSLIRRRAAQRKLKQLKADAK     SVNHLKEVSYKLENKVIELTQ.[13].ERIKELQVQ.[1].EESAKLQETLEN 987  baker's yeast

15214090  998 .[13].RLDDELLLKQRSYD.[ 3].QELREENASLKDQCRTY.[5].SLVSKYSETESELNKKEAELVIFQKEITEYR 1080 fission yeast
19074177  997 .[ 1].DSEVQALKEKVKEK.[ 4].ERILEGMKRMEREGEER.[1].RMLKENESTIDELRTRCLNMKRWKDEYAELR 1064 Encephalitozoon cuniculi
19173319  801 .[ 1].DVVESSICMVGEVS      LKLHMFERNIHKVSFIL.[1].NLIEYEGILRRQGIGSIDEVKGLVSILFKHL 864  Encephalitozoon cuniculi
19112194  917 .[ 1].QVIVGPTIQYCRKP      GKVQTVKTAKDETTKDY     DYYKSGTIHVGTGLPPTSKSKPFPRLATGGS 979  fission yeast
19113025  953 .[ 2].DFSEPVSMDFTSND.[ 3].VQLLQAESKLRQASQQL.[1].MAAKKSELGFVQSQTARENLSNYYQALQMTV 1020 fission yeast
19075992  963 .[ 2].EAKLAQERELEQTR.[ 2].ISDQSQDGELKELLEEK.[1].NALIMMEEEMRQVNDANTELLRVNATLKSQL 1029 fission yeast
12643253  956 .[ 2].ELESLRENNATVLS.[ 2].AEFNEQCKSLQETIVTK.[1].AELDKLTKYISDYKTEIQEMRLTNQKMNEKS 1022 fission yeast
417335    971       DLSNIPSKQRQEYE.[ 3].NGYNDKISKLKTLQVEI.[1].NTLNKKNALKERKKKQSSLIQSHMQSLAAIK 1036 baker's yeast
730092   1027 .[13].SSEEDLDIKLVTLE.[10].QSLVTENSDLRSKNENF.[5].ALNNQLKNKESELLKMKEKIDNHKKELATFS 1116 baker's yeast
6322720   912 .[ 1].MIKVGPTIEYHKQP      NKLHTVRSKISDSAPKY.[1].DIYKSSTIYVRRGHPANSKSNKKPKNPGGLS 975  baker's yeast
2498024   913 .[ 1].QIKIGSAIEYQKKP      GKLHSVKCQINESAPKY.[1].DIYKSSTISVRRGNPPNSQVHKKPRKKSSIS 976  baker's yeast
127736    988 .[ 7].DIDNQKSKDMELQK.[ 3].NNLQSTEQTLKDAQLEL.[1].DMVKQHDELKEESKKQLEELEQTKKTLVEYQ 1060 baker's yeast

15214090 1081 .[7].QNP.[1].KTHNIN.[5].PLNSDENIY.[1].TSSTTLSILK.[2].QELKS.[2].TKEANQL.[22].R 1161 fission yeast
19074177 1065 .[6].QKK.[2].DEVEDM.[5].RLHNEIRKI.[1].KEREELGRMQ.[4].DDLEF.[8].EKAFQEL.[12].K 1143 Encephalitozoon cuniculi
19173319  865 .[3].QRS     SLLEVL.[5].EHQQLSKFK.[1].SEGYFKRIFK.[4].SKLIR     LLEYFYH.[ 6].I 924  Encephalitozoon cuniculi
19112194  980      TAA.[1].RGPRPV.[2].NKPAATKPV     SMPAAKSKPA.[2].ANPVS     TAQQTQN.[ 9].R 1034 fission yeast
19113025 1021 .[4].EYD.[1].EQLPSR     VLFYAMDRY.[1].SIHKKLKQLL.[2].VGVEN.[2].LLPNEVV.[10].K 1081 fission yeast
19075992 1030 .[7].VEQ.[1].SQLKEK.[5].SLTKATKIL.[1].SASSIEQSRN.[2].EKSRR.[2].SLMEMRT.[ 9].N 1097 fission yeast
12643253 1023 .[7].SES.[1].KRVKKL.[5].TLISDVSIL.[1].QQKEELSVLK.[2].QELTI.[3].EEKVNYL.[11].K 1093 fission yeast
417335   1037 .[7].SDE.[1].KSMKQE.[2].FIENVIAQD     FTTTYSANKN     DKVKG.[1].GIAGQQV.[ 9].R 1097 baker's yeast
730092   1117 .[7].SEH.[4].AELKET.[5].EYKSNYQKI.[1].EEYSNFQRET.[2].QEQKK.[9].DSKIKEL.[31].R 1216 baker's yeast
6322720   976 .[2].PIK.[1].KKSKHK.[2].HKHTHSHRS     HRDAAKKQPL.[2].QKPVN     PLSLRAT.[ 8].K 1031 baker's yeast
2498024   977 .[3].HAS.[1].SQATRR.[2].SIAAAQHVP     TAPASRHSKK.[2].PPPPG     MQNKAAT      R 1025 baker's yeast
127736   1061 .[6].QNE.[1].KSLKEE.[2].RLQTAMSLG     TVTTSVLPQT.[2].KDVMG.[9].MLENSDL.[26].R 1147 baker's yeast

15214090 1162 .[16].QDQETEIISLNAD.[3].LKDTNGV.[2].KNASDFIDFQGIKS.[4].KISDLLNQ.[8].GLLKQK.[23]. 1265 fission yeast
19074177 1144 .[13].EKTRGLERRVKSL.[8].MANRQLM.[4].EMYREIHVLQQSKL.[5].REAGFNSI.[8].QRLEME.[22]. 1251 Encephalitozoon cuniculi
19173319  925 .[ 6].ESVNYLLKTINVS     VFNEILV.[1].RNFLSFNRGVQINY.[3].EIDKFCRS.[1].NYLEGM.[ 6]. 989  Encephalitozoon cuniculi
19112194 1035 .[ 5].AAAPVTSTTTTIK.[1].ATTVSAS.[2].APSTVTSAASSPSN     ISKPSAPV.[2].NVSKPS.[ 4]. 1096 fission yeast
19113025 1082 .[11].LTVSSLFNAVGYK.[7].ETDQNSL.[2].AGVVNFLIFAGISL.[4].QISEFLSQ.[3].YFTKIV.[21]. 1177 fission yeast
19075992 1098 .[14].GRTFTTLKTLLLK.[5].AQKLDHL.[2].AKLLFIIISQMWKS.[4].ESVALVER.[3].HTLEYV.[23]. 1196 fission yeast
12643253 1094 .[14].QATKNKELEAKVK.[7].SLTKELE.[2].EEKCQNLSDASLKY.[4].EIHENLLL.[2].SDLENY.[23]. 1193 fission yeast
417335   1098 .[19].EVTEGYLKKVNVT.[1].VNGDNVL.[2].IHVITTVVSSLVRN.[4].QSSKFISK.[2].LTVESI.[23]. 1196 baker's yeast
730092   1217 .[26].EITRNLENEIEEK.[8].FTETRLA.[2].SFEDQKIKAQMKKL.[5].DMDPSIPL.[8].DNCPDK.[23]. 1336 baker's yeast
6322720  1032 .[ 2].KTVPIKSSAIPAA.[1].VSSKHSS.[2].SSKEKVAVKKASSS     HKSSSAKQ.[2].VSMPPS.[23]. 1109 baker's yeast
2498024  1026       RSVPNPASTLTAS.[1].SNARPSP.[1].TAATRATPAATPAA     AAMGSGRQ     ANIPPP       1075 baker's yeast
127736   1148 .[25].EITEGLLKGFEVP.[7].LSKRDVV.[2].ARILIIVLSEMWRF.[4].QSESFLAQ.[2].TTIQKV.[23]. 1258 baker's yeast

15214090 1266 H.[3].PLKRI.[ 4].DDRKIDNKLLKTISK.[1].LDALQLTVE.[1].ELSNLYSLSKDLSFTD.[6].NSI.[8]. 1337 fission yeast
19074177 1252 S.[3].RFCGM.[ 8].KEIEYQASEHENRNV.[1].LSSEVEMLR     EMVEMERRSKEEVIRG.[9].AIA.[8]. 1329 Encephalitozoon cuniculi
19173319  990 T.[3].RLINL.[ 1].ESRATADSILDECSI.[1].NCVQINEIV.[1].KLDAEASYFFGDDNRS.[1].KFI.[1]. 1046 Encephalitozoon cuniculi
19112194 1097 P.[3].PPAEV      EKKDLYLALYDFAGR     SPNEMTIKK.[1].EIIEIVQKEPSGWWLA.[1].KNG.[4]. 1154 fission yeast
19113025 1178 L.[1].WFATL.[ 1].KIRSFLVHLLSINSH.[1].KQSVVEDLW.[1].PLILKFSKHFSNLENS.[6].KLL.[8]. 1244 fission yeast
19075992 1197 L     AFVYT.[ 1].QQAFKHSSAFTLLST.[1].SHESVQTIF.[1].MIESHLSKIFFEWVRQ.[6].PLI.[4]. 1258 fission yeast
12643253 1194 L.[3].HRDLT.[ 3].ESLLRQSASYKEKLS.[1].ASSENKDLS.[1].KVSSLTKQVNELSPKA.[4].ELE.[5]. 1259 fission yeast
417335   1197 P     AFAAN      QKTLYEANGGDEKDK.[1].TLIYLNDLE.[1].ETLKVFDKIYSTWLVK.[3].HAS.[1]. 1251 baker's yeast
730092   1337 A.[3].AENAI.[12].ESSLSSSDIYKLKFE.[1].SEERVKSLE.[1].KLKTMPLRDRTNLPVG.[6].DSI.[8]. 1416 baker's yeast
6322720  1110 P.[3].PPMGQ      PKDPKFEAAYDFPGS.[1].SSSELPLKK.[1].DIVFISRDEPSGWSLA.[3].DGS.[4]. 1170 baker's yeast
2498024  1076 P.[3].PPSSK      PKEPMFEAAYDFPGS.[1].SPSELPLKK.[1].DVIYITREEPSGWSLG.[3].DGS.[4]. 1136 baker's yeast
127736   1259 Y.[3].VFALN.[ 3].TEETFKNGMTDEEYK.[1].YVSLVTELK.[1].DFEALSYNIYNIWLKK.[3].QLQ.[4]. 1322 baker's yeast

15214090 1338 TLSELKERLN.[11].FKDTQAIMNS.[5].NPNSDA.[232]. 1611 fission yeast
19074177 1330 LGNEIDMAIE.[17].KECKEQVMSK.[6].LNGRIV.[237]. 1615 Encephalitozoon cuniculi
19173319 1047 DPTVTLPSYT.[ 5].SFICPRYLPS.[5].ILKSIR        1082 Encephalitozoon cuniculi
19112194 1155 VPATYVTEYK.[ 2].TPQTTASSTN     VAAQAN.[ 35]. 1217 fission yeast
19113025 1245 NALLNSKCLP.[ 7].ENTTPTGMNI.[5].RMNLIH.[189]. 1471 fission yeast
19075992 1259 IITGTNTDAG.[ 8].KFFEKPKYKI.[5].VLNKVH.[204]. 1501 fission yeast
12643253 1260 LMHEYSQLGK.[ 6].RKALIASRDN.[5].LKSELE.[220]. 1516 fission yeast
417335   1252 HIEIFDMVLN.[ 2].LFKNSGDEKF.[5].FLNEFD.[187]. 1471 baker's yeast
730092   1417 YYKLENYKLQ.[13].TLDLRQSKSK.[6].QLDRLQ.[230]. 1691 baker's yeast
6322720  1171 VPTAYMTPYK.[ 5].VPVAATGAVN.[5].KSSQID.[ 65]. 1271 baker's yeast
2498024  1137 VPTAYMKPHS.[ 4].IPTPPQNRDV.[5].NSVQHD.[ 48]. 1219 baker's yeast
127736   1323 NAVVISESLP.[13].IFANTEEYTM.[5].FFNSIY.[201]. 1567 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap