Conserved Protein Domain Family
Smc

?
COG1196: Smc 
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning]
Statistics
?
PSSM-Id: 224117
View PSSM: COG1196
Aligned: 60 rows
Threshold Bit Score: 271.973
Threshold Setting Gi: 15594391
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

6323115   154 .[1].FINELVLENFKSYAG.[2].VVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFR     ANKMRQDRLSDLIHKS 221  baker's yeast
19074461    5 .[1].FRKTIVSVELIKFMC.[3].LLISLRKPLTIVSGCNGSGKSAIMVAIGLVFGQR.[1].SHLERGSSFKDLIKSK 74   Encephalitozoon cuniculi
19173313    1 .[1].HIKQIRLKNFRSFRD.[1].VVVPLSEHTNIIVGRNGSGKSSIVSAVHFVLCGE.[2].SCESRTGLIHEGSRAM 69   Encephalitozoon cuniculi
19075000    7 .[1].NIVSMELENFQTFKK     MSLGFCSSFNFIAGPNGSGKSSIANAMVLVFGGT.[1].KVIGRGKTVGEYVRFG 73   Encephalitozoon cuniculi
19114172    1 .[1].YITKIVIQGFKSYKD.[2].VIEPLSPHHNVIVGRNGSGKSNFFAAIRFVLSDA     YTHLSREERQALLHEG 68   fission yeast
8489009     8 .[1].ALGSIVRIKLVNFVT.[3].CELFPGPYLNLIIGPNGTGKSTIVSAICIGLGWP.[1].KLLGRAKEAREFIKYG 77   fission yeast
1709997     1      MTTELTNVSLEEAIT.[2].TSENRRKRDSDVLQTEEVDLSNVKRIRASRNQDN.[2].ERQSRLQRSSSLIEQV 69   fission yeast
730753      1 .[1].KVEELIIDGFKSYAT.[2].VITDWDPQFNAITGLNGSGKSNILDAICFVLGIA.[1].MSTVRASSLQDLIYKR 69   baker's yeast
1352989     1 .[1].YIKRVIIKGFKTYRN.[2].IIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDD     YSNLKREERQGLIHQG 68   baker's yeast
6324539    37 .[1].QPGSIIKIRLQDFVT.[3].TEFNLSPSLNMIIGPNGSGKSTFVCAVCLGLAGK.[1].EYIGRSKKVEDFIKNG 106  baker's yeast

6323115   222 EAF.[9].VHFQYVIDESS.[12].IITRKAFK     NNS.[2].YYINEKESSYT     EVTKLLKNEGIDLDHK 296  baker's yeast
19074461   75 ESN     AAVRIVLENHR.[11].IIEKRIGM.[1].SAT.[1].SIMNGERRVWS.[4].DLETVLEFFALRFENP 143  Encephalitozoon cuniculi
19173313   70 EEE     GSVEIVFCDGL.[ 9].SVKRTVSV.[1].KDE     YMVDNRIVSRD     ELVGLLQTNGFAVGSP 131  Encephalitozoon cuniculi
19075000   74 ERE     AKIEVVVWIKG.[ 3].RLCRCISK     DSQ.[2].YFVDGKSYKKT     EYEEFVGRFKKNIGNL 130  Encephalitozoon cuniculi
19114172   69 PGA.[4].AYVEVTFANAD.[ 9].VVLRRTIG.[1].KKD.[1].YSLDKKTVSKT     EVINLLESAGFSRSNP 135  fission yeast
8489009    78 KNT     ATIEIEMKYRD.[ 4].TITRQISQ     DKS.[2].FSINREACATS     SITSLMDTFNVQLNNL 135  fission yeast
1709997    70 RGN.[8].NQTRETNSNFD.[14].MCHDSLKI.[1].FGP.[2].NFVIGHNGSGK.[7].TICLGAKASNTNRAPN 153  fission yeast
730753     70 GQA.[4].ASVTIVFDNTD.[14].SVTRQVVL     GGT.[2].YLINGHRAPQQ     SVLQLFQSVQLNINNP 141  baker's yeast
1352989    69 SGG.[4].ASVEIVFHDPD.[16].VTIRRTVG.[1].KKD.[1].YQLNDRNVTKG     DIVRMLETAGFSMNNP 142  baker's yeast
6324539   107 QDV     SKIEITLKNSP.[15].KITRIITR.[1].KRR.[2].YLINDYQVSES     VVKTLVAQLNIQLDNL 176  baker's yeast

6323115   297 .[1].FLILQGEVENIAQMKPKAEKE.[7].YLEDIIGTANYKPLIEERMGQIENLNEVCLE     KENRFEIVDREKN 369  baker's yeast
19074461  144 .[1].NFLTQEQAKRFLSTMDPEMLY.[1].LFMQGTEIAEICRLNSESMSNVEAMRRRISL     VAEELDGIEKRIK 210  Encephalitozoon cuniculi
19173313  132 .[1].FVVLQEEVSELAVVDDRRRYE     LMKNVAGVSGYEKDRESSMSILEETKQSEKK     IELLLERVEDKLR 197  Encephalitozoon cuniculi
19075000  131 .[1].QFLPQEKVSEFTRLPPENLLV.[3].LAVGEEEVLEYLKELEDLEAERDRLVETLES     CTRKKECIERAIE 199  Encephalitozoon cuniculi
19114172  136 .[1].YIVPQGRVTSLTNAKDSERLE     LLKEVAGTQIYENRRAESNKIMDETIQKSEK     IDELLQYIEERLR 201  fission yeast
8489009   136 .[1].HFLPQDRVAEFAQLDPYSRLM.[3].RAIDHEGLLPAHEKLIDLRKREREILQNKNQ     GQSTLNSLKDRQQ 204  fission yeast
1709997   154 .[2].SLVKQGKNYARISVTISNRGF.[2].YQPEIYGKSITIERTIRREGSSEYRLRSFNG.[2].ISTKRDELDNICD 224  fission yeast
730753    142 .[1].FLIMQGKITKVLNMKPSEILS     LIEEAAGTKMFEDRREKAERTMSKKETKLQE.[1].RTLLTEEIEPKLE 208  baker's yeast
1352989   143 .[1].NIVPQGKIVALTNAKDKERLQ     LLEDVVGAKSFEVKLKASLKKMEETEQKKIQ     INKEMGELNSKLS 208  baker's yeast
6324539   177 .[1].QFLSQERVEEFARLKSVKLLV.[2].IRSIDASLLDVLDELRELQGNEQSLQKDLDF     KKAKIVHLRQESD 244  baker's yeast

6323115   370 SLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNS     KLASTLEKISSSNKDLEDEKMKFQESLKKVDEIKAQRKE 444  baker's yeast
19074461  211 DEEGVLDAINNAKDMEKTILCLEDEMVWARVNEKRM     QMEKCFERFRDKQEEMDKYSERLEELSQAIGEARKRMNS 285  Encephalitozoon cuniculi
19173313  198 GLESDKKEAELCEELEKEKRRLEYGYIEREVREING     EIFRIEELVSSDPEEVSEESGDFGCEIGEIENKLTNLIN 272  Encephalitozoon cuniculi
19075000  200 VLGRDVEKVCEEGRKRERIRVMREKQEWMHYKHHTD     EYVAIKKAVGLLRKQIEVKNKEVLKIEDKIIELKSSETC 274  Encephalitozoon cuniculi
19114172  202 ELEEEKNDLAVYHKKDNERRCLEYAIYSREHDEINS     VLDALEQDRIAALERNDDDSGAFIQREERIERIKAEITE 276  fission yeast
8489009   205 ALEKEVNIFKEREKIKSYIEMLGLAKMLVIYREKTN     VFNQLRADKKKLKKDLKDLVEEFQPILDKGEELRSDLKL 279  fission yeast
1709997   225 HMGLQIDNPMNILTQDTARQFLGNSSPKEKYQLFMK.[2].QLKQLEENYSLIEQSLINTKNVLGNKKTGVSYLAKKEEE 301  fission yeast
730753    209 KLRNEKRMFLEFQSTQTDLEKTERIVVSYEYYNIKH     KHTSIRETLENGETRMKMLNEFVKKTSEEIDSLNEDVEE 283  baker's yeast
1352989   209 EMEQERKELEKYNELERNRKIYQFTLYDRELNEVIN     QMERLDGDYNNTVYSSEQYIQELDKREDMIDQVSKKLSS 283  baker's yeast
6324539   245 KLRKSVESLRDFQNKKGEIELHSQLLPYVKVKDHKE     KLNIYKEEYERAKANLRAILKDKKPFANTKKTLENQVEE 319  baker's yeast

6323115   445 IKDRISSC.[10].RRELEGTRVSLEERTKNLVSKMEKAEKTLKSTKHSISEAENMLEE.[ 6].EHETEIKDLTQLLEK 528  baker's yeast
19074461  286 IEAEEGER.[ 7].SEEIDGMISRLRMRRREICNDSEELKEARDFKKKIVSDFEKQDGT.[ 3].LLPQLEDKHKRIASE 363  Encephalitozoon cuniculi
19173313  273 RRKELHVN.[ 2].YKDKEPEIKDEMKKIEKKRSDLQDTQKVERERLVKLRDEERENFV.[ 2].GYIKYLTGFLETLGS 344  Encephalitozoon cuniculi
19075000  275 KEMDGLWS.[ 1].LREHDTNLVKVVEELRDIHQETEMLGVDEESLKNKREKRMTNLER.[ 3].EILDLQDEVSKVEIP 346  Encephalitozoon cuniculi
19114172  277 LNHSLELL.[17].KVALELQSSQLSRQIEFSKKDESSKLNILSELESKISEKENELSE.[10].EADDLNKRIMLLKNQ 371  fission yeast
8489009   280 KDDTFNDY.[ 1].SASMELNTSNLRARASFSNFMENEKKLYEKVNTNRTLLRNANLTL.[ 1].EAQQSVKSLTERQGP 349  fission yeast
1709997   302 YKLLWEQS.[11].QKKGEMVWAQVVEVEKELLLAEKEFQHAEVKLSEAKENLESIVTN.[ 6].KISSKEEVIGRAKGE 386  fission yeast
730753    284 IKLQKEKE.[13].ENGLLNEISRLKTSLSIKVENLNDTTEKSKALESEIASSSAKLIE.[ 3].AYANTEKDYKMVQEQ 367  baker's yeast
1352989   284 IEASLKIK.[18].LTNVNVKIKDVQQQIESNEEQRNLDSATLKEIKSIIEQRKQKLSK.[ 6].ELTKEEAMYKLQLAS 375  baker's yeast
6324539   320 LTEKCSLK.[10].INEIFEKLNTIRDEVIKKKNQNEYYRGRTKKLQATIISTKEDFLR.[ 3].ILAQTHLPEKSVFED 400  baker's yeast

6323115   529 ERSILD.[ 8].K.[1].KNISAEIIRHEKELEPWDLQLQEKESQIQ.[51].KD.[1].RSQGEKNFTSAHLKLKEMQK 647  baker's yeast
19074461  364 VETLQG.[ 7].E.[1].RECREKAKVEEEAASEREGRILHLRKQIE.[ 4].ND.[1].NSFFGPSFPAAMDEISRTKF 434  Encephalitozoon cuniculi
19173313  345 RNIKAG.[ 4].A.[1].SILKEKLEKLRALNSSGRHEAENAEETRD.[ 4].IE.[1].RKHLWREEKRLRLLDASIEE 412  Encephalitozoon cuniculi
19075000  347 PQPRGP.[ 3].R.[1].EVLEEKMSGLMRARGKIQHESSELKRLVD.[20].RK.[1].HPDTHRAVCWLRENKHRFKD 429  Encephalitozoon cuniculi
19114172  372 KQSLLD.[ 6].Q.[1].TTKKERDEWIRNQLLQINRNINSTKENSD.[51].TD.[1].RKSLWREEAKLKSSIENVKD 488  fission yeast
8489009   350 RPSDNG      V     QDLQEKMQEVNAEKLQHENEKLESSHELG.[10].ID     LDNIKRELSYYNDATKRKLD 417  fission yeast
1709997   387 TDTTKS.[ 7].T.[1].DGYRSEMNDVDIQKRDIQNSINAAKSCLD.[52].HS.[1].LLEMGGNLTSLLTKKDSIAN 505  fission yeast
730753    368 LSKQRD.[ 7].L.[1].STLTTGISSTGAADGGYNAQLAKAKTELN.[51].RA.[1].LVEYGFDPSRIKDLKQREDK 485  baker's yeast
1352989   376 LQQKQR.[10].R.[1].KSKDERDTWIHSEIEELKSSIQNLNELES.[53].LD.[1].RKELWRKEQKLQTVLETLLS 498  baker's yeast
6324539   401 IDIKRK.[ 4].K.[1].GEIRDLISEIDAKANAINHEMRSIQRQAE.[14].LN.[1].DQDLKEVRDAVLMVREHPEM 478  baker's yeast

6323115   648 V.[42].RLGDL.[2].IDD     SFDVAISTACP     RLDDVVVDT.[3].AQHCIDYLRK.[1].KLGYARFILL 744  baker's yeast
19074461  435 N.[ 5].PIAFE.[2].VKE.[1].RWSKAISIVLN.[1].SLSTFIVTN.[3].KDALLRIFRR.[1].KVDFPISTLS 496  Encephalitozoon cuniculi
19173313  413 M.[30].YVYDL.[2].VPN     ELVNAFEAVVG.[1].ALFNIVVSN.[3].ASKVLKKMKD     LRFRITLMPL 497  Encephalitozoon cuniculi
19075000  430 E.[28].LSPFI     CKS.[1].EDFETFVRIMK.[1].EKKWMINAI.[3].KMDGKMGIKE.[1].AISREMLKEL 512  Encephalitozoon cuniculi
19114172  489 D.[37].PLCEL.[2].VDN     RFKVAVEATAG.[1].SLFHIVVDN.[3].ATQILDVIYK.[1].NAGRVTFMPL 581  fission yeast
8489009   418 F.[30].PIYMN.[2].CKE.[1].GFAALIEGFFR.[1].DTFRTFIMS     NYNDYLKLMD.[1].ITSKTKYTPT 501  fission yeast
1709997   506 K.[45].PMGKY.[2].VKE.[1].KWHLIIERILG.[1].VINGFIVRS.[3].QLILKELMRQ.[1].NCHATVVVGK 607  fission yeast
730753    486 L.[42].QLFQI.[2].DNI     RYATALQTCAG.[1].RLFNVVVQD.[1].QTATQLLERG.[1].LRKRVTIIPL 581  baker's yeast
1352989   499 D.[39].TLGEL.[2].VND     KYKTCAEVIGG.[1].SLFHIVVDT.[3].ATLIMNELYR.[1].KGGRVTFIPL 593  baker's yeast
6324539   479 K.[16].QFAAY.[2].QCV     DYNTSKALTVV.[1].SDSYKLFAN.[3].DKFKVNLREL.[1].SADTTPPVPA 550  baker's yeast

6323115   745 DRLRQFNL.[14].LVKPKNP.[3].N.[1].FYSVLRDTLVAQNLKQANNVAYGK.[1].RFRVVTVDGKLIDISGTMS 822  baker's yeast
19074461  497 SRVPEVIK.[ 5].RYTSVLD.[3].V.[1].NPFVMNYLIITTSIEQTILVESRK.[1].AYEIIRSRPAFVECAYTRN 565  Encephalitozoon cuniculi
19173313  498 SRIKYRES.[13].QLRCGQQ.[2].A.[1].LRCVVKDFYLCSDLKQALYSSKKY     EINTVTLSGEIVTRDGPIS 572  Encephalitozoon cuniculi
19075000  513 GFEGVLSN      FIECRDE.[4].L.[1].VAGHFDSIPVSKGSVDESLVFRKT     NIKRMAAGGRYIEIKKSKY 576  Encephalitozoon cuniculi
19114172  582 NKLRPKAV.[12].QYLEFDP.[3].A.[1].IKQVFSKTIVCPSIETASQYARSH     QLNGITLSGDRSDKKGALT 656  fission yeast
8489009   502 IREFSSER.[ 2].KIEDFEP.[4].E.[1].LQSFGFDGYVIDFLEGPEVVLVAL.[2].MLKIHQIPIAKRELPPASV 569  fission yeast
1709997   608 YDPFDYSS.[11].KIIKFDD.[1].E.[1].LHTLINHLGIEKMLLIEDRREAEA.[2].KRGIANVTQCYALDPRNRG 681  fission yeast
730753    582 DKIYTRPI.[20].NLIRFDE.[3].K.[1].MEFIFGNSLICEDPETAKKITFHP.[2].RARSITLQGDVYDPEGTLS 666  baker's yeast
1352989   594 NRLSLDSD.[17].KKIKYEP.[3].K.[1].VKHVFGKTIVVKDLGQGLKLAKKH     KLNAITLDGDRADKRGVLT 673  baker's yeast
6324539   551 ETVRDLGF.[ 5].DFITGDK     R     VMKMLCQTSKIHTIPVSRRELTPA.[2].KKLITPRPNGKILFKRIIH 616  baker's yeast

6323115   823 GG.[31].RELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEME.[17].AEMAYVK.[3].D.[23].ETK 953  baker's yeast
19074461  566 GD.[ 2].RLVGGSMSDFVTRGVDRFYFENAHEKLERCRAEMKRLAEERVER      RWERRLK.[3].N      EMD 627  Encephalitozoon cuniculi
19173313  573 GG.[ 1].EKRNAVFQEYKKISREARKVKGEISRVQHELGKIGKEIEEAKMS.[ 4].SDGSRYN     E.[ 4].VVL 638  Encephalitozoon cuniculi
19075000  577 GS      EHVIIYNPLKSRNLFSQNLSLQELGEIEDDLAKKNSTRRENEEK.[ 2].KVLKDCE.[3].K.[ 8].RSL 646  Encephalitozoon cuniculi
19114172  657 AG.[19].IKFSDLQESLEKCRSEIESFDQKITACLDDLQKAQLSLKQFERD.[16].DLQESMH.[3].R.[14].QAN 765  fission yeast
8489009   570 NA.[ 2].NFRLANGDPVLKTYLAGSSIHLVFRSAYGDREITRRTDPLPSRS.[17].QLNAQLS.[3].N.[10].KVN 658  fission yeast
1709997   682 YG.[ 1].RIVSTQRSSGISKVTPWNRPPRIGFSSSTSIEAEKKILDDLKKQ.[16].KFKRDEQ.[3].E.[ 7].RIL 765  fission yeast
730753    667 GG.[19].KQIETIQADLNHVTEELQTQYATSQKTKTIQSDLNLSLHKLDLA.[17].EILRDIG.[3].N.[14].EVS 776  baker's yeast
1352989   674 GG.[20].SQHKKILEELDFVRNELNDIDTKIDQVNGNIRKVSNDRESVLTN.[16].ILEESLN.[3].L.[14].KLN 783  baker's yeast
6324539   617 GN.[ 5].KQSAYGSKQVFPTDVSIKQTNFYQGSIMSNEQKIRIENEIINLK.[15].QKSGYRH.[3].E.[ 6].DIN 702  baker's yeast

6323115   954 TKKEKIKGL.[10].KLQMQNSKVE.[8].LVAKLKKVKSASK.[24].DELKV.[1].EEQLK.[2].KLALAENDTNM 1051 baker's yeast
19074461  628 KVSEDIESR.[ 5].ALRVEMDHER     HIHDTQMEIMKND.[ 3].EEIRS.[1].THQIS.[2].EKKQSEISEEI 691  Encephalitozoon cuniculi
19173313  639 FLQEKIRIL.[ 4].KGNLDINKIS.[8].EEKDLRLKSIWTG      NEIRK.[1].EIRVG.[2].EIGIKKLNDSS 706  Encephalitozoon cuniculi
19075000  647 HNSQVMDIK      RREARIQILK.[8].ELEMLEDTKDLDE.[ 2].RRIYE.[1].RRKLE.[3].KDKCDELDRHL 713  Encephalitozoon cuniculi
19114172  766 DLKSELSSE.[ 6].KDVEALKSLS.[8].EFDAIIKERAHIE.[22].AEIGS     DNRID     ESELNSVKRSL 854  fission yeast
8489009   659 EHESLLSRT.[ 6].LRKERDEKLI.[9].ERIEHQTLLLRQR.[ 8].AEIEK.[1].EDIRK.[2].FEALMNSVLKV 737  fission yeast
1709997   766 LKRREVNSL.[ 6].VLDTEKIQTL.[9].ELESYAGQLQDAK      NEEHR.[1].RDNQR.[2].IEEIRIYREKI 836  fission yeast
730753    777 TIEKDMKEY.[ 6].KLNELKKELK.[8].QESESERKYDLFQ.[24].KSIES.[1].KLENS.[2].EGKIRGVEDDL 870  baker's yeast
1352989   784 TFENDLLQE.[ 7].EEKERLESLT.[8].KLNITSDALEGIT.[22].SKMSE.[1].GDAFI.[3].QDELKELQLEK 877  baker's yeast
6324539   703 REAHQLNEI.[ 5].MRKSTIETLR.[9].ARKDVSQKIKDID      DQIQQ.[1].LLKQR.[2].LSKMASSMKSL 772  baker's yeast

6323115  1052 N.[2].LNLKVELK.[3].EQLKEQMEDMEESINEFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLN.[16].NKMDS 1136 baker's yeast
19074461  692 E.[2].EREKKEIR     EYKGAGTGRLRQEISRNTAEASEVRRRIDMWRTDILKLKEEHQKQVELYN.[ 1].EKSLA 758  Encephalitozoon cuniculi
19173313  707 R.[2].ESELEKSK.[3].EAMEIEAKILELKDKKRAAREMMFNEENAGLFAKPKKINIEMEKLVRRKH.[ 4].KRSEL 779  Encephalitozoon cuniculi
19075000  714 S     DSRYFDAF.[3].VRLFREVMNVNKNIEFLEESKKVMEETIRKLDEEAAEKKKEGSILKRKIE.[ 1].GRMRL 781  Encephalitozoon cuniculi
19114172  855 L.[2].ENKLQIIK.[3].SGLEEQMQRINSEISDKRNELESLEELQHEVATRIEQDAKINERNAAKRS.[ 3].ARKKE 926  fission yeast
8489009   738 K.[2].SIKATNNF.[3].LGSRLNVIEAKYKLEKHEMDANQVNARLTEVQDRLKDITDKLASAREDAM.[ 4].SVVDS 810  fission yeast
1709997   837 Q.[2].TQRLSSLQ.[3].SRLRDEKRNSEVDIERHRQTVESCTNILREKEAKKVQCAQVVADYTAKAN      TRCER 905  fission yeast
730753    871 V.[2].QTELNEEK.[3].MDIDDELNELETLIKKKQDEKKSSELELQKLVHDLNKYKSNTNNMEKIIE.[ 3].QKHEF 942  baker's yeast
1352989   878 E.[2].EKQHENAV.[3].GTVQREIESLIAEETNNKKLLEKANNQQRLLLKKLDNFQKSVEKTMIKKT.[ 3].TRREE 949  baker's yeast
6324539   773 K.[2].QKELISTQ.[3].FEAQNMDVSMNDVIGFFNEREADLKSQYEDKKKFVKEMRDTPEFQSWMRE.[ 2].SYDQD 843  baker's yeast

6323115  1137 VKEDVKNNQELDQE.[47].ELDVELIESK.[7].VEETN.[4].VLEEYARRLAEFKRRKLDLNNAVQKRDEVKEQLGI 1258 baker's yeast
19074461  759 LESGKKEMEARAED.[ 2].KREIAYIKAQ.[3].CRGIG.[4].ALGTLEHLKRMRRGKEDLLREYDEKIRTALEGIES 831  Encephalitozoon cuniculi
19173313  780 CERIGVSDFRNLER.[10].MNEMARINER.[3].LSVVN.[2].AISQWENYMEQRDSMKRRLEDLKCDKRRILDFIAE 858  Encephalitozoon cuniculi
19075000  782 EKIEKTEEYDKILA.[ 7].ELDDEIIKER.[2].LKLYN.[4].AVEQFEVREQDLRSLNKDISRHSEGLENIKKKGSD 858  Encephalitozoon cuniculi
19114172  927 CNEKIKSLGVLPEE.[13].VKKLHKINEA.[3].YGSVN.[2].AYEQFNNFTKQRDSLLARREELRRSQESISELTTV 1008 fission yeast
8489009   811 LQTQSSDRQTAITE.[11].DNKISIEETK.[2].FMNVN.[2].VMEQYDARKKEIEELESKMSDFDQSVEELQDEMNS 889  fission yeast
1709997   906 VPVQLSPAELDNEI.[10].RNRTGVSVEQ.[2].EDYLN     AKEKHDQAKVLVARLTQLLQALEETLRRRNEMWTK 981  fission yeast
730753    943 LEDFDLVRNIVKQN.[ 9].ERSKQLNEKF.[3].RKKVN.[2].IMNMIENVEKKEAALKTMIKTIEKDKMKIQETISK 1020 baker's yeast
1352989   950 LQQRIREIGLLPED.[14].LQRLNDMNTE.[3].LKNVN.[2].AFENFKKFNERRKDLAERASELDESKDSIQDLIVK 1032 baker's yeast
6324539   844 TKEKLNKVAEKYEE.[ 9].QDVLDKLESE     IAMVN.[4].AVTILDQVTAELRELEHTVPQQSKDLETIKAKLKE 920  baker's yeast

6323115  1259 LKKKRFDEFMAGFNIISMTLKEMYQMI.[5].AELELVD.[ 7].GVTFSVMPPKKSWR.[4].LSGGEKTLSSLALVFA 1338 baker's yeast
19074461  832 RIVKRDSMRNEIARRAAEEFSRLTKAR.[3].GALEFDH.[ 5].DVQLRVHGQSEVGS.[3].LSGGERSFASVSLLLS 906  Encephalitozoon cuniculi
19173313  859 LDSKKEDTMKNAISLVKEGFSELYSRL.[5].AELYSYE.[ 1].GIGIKIGENISANL     LSGGQKAVVALCLIFS 928  Encephalitozoon cuniculi
19075000  859 VKNVLIERIEKMVCSIDKQFRSLFRRA.[5].VVFINDG.[10].MVKFRDSDGLEVLN.[3].QSGGERSVSIILFLLA 940  Encephalitozoon cuniculi
19114172 1009 LDQRKDEAIERTFKQVAKSFSEIFVKL.[5].GELVMNR.[29].GISIRVSFNSKDDE.[6].LSGGQKSLCALTLIFA 1112 fission yeast
8489009   890 IKEDWVSKLEENVQCISDRFSKGMSGM.[3].GEVRLGK.[ 8].IDILVQFREEEGLQ.[6].QSGGERSVSTIMYLLS 970  fission yeast
1709997   982 FRKLITLRTKELFELYLSQRNFTGKLV.[2].HQEEFLE.[ 6].NRNLATAHNRHEKS.[6].LSGGEKSFATICMLLS 1059 fission yeast
730753   1021 LNEYKRETLVKTWEKVTLDFGNIFADL.[5].AKLVPCE.[ 6].GLEVKVKLGNIWKE.[4].LSGGQRSLIALSLIMA 1099 baker's yeast
1352989  1033 LKQQKVNAVDSTFQKVSENFEAVFERL.[5].AKLIIHR.[34].GVSISVSFNSKQNE.[6].LSGGQKTVCAIALILA 1141 baker's yeast
6324539   921 DHAVLEPKLDDIVSKISARFARLFNNV.[3].GAVRLEK.[ 8].IEIMVKFRDNAPLK.[6].QSGGERAVSTVLYMIA 1001 baker's yeast

6323115  1339 LHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT     KNAQFIVISLRNNMFELAQQLVGVYKRD.[1].RTKSTTI 1409 baker's yeast
19074461  907 LWPSLSCPIKVLDEFDVFMDNLNRKHAIRQLLGFF.[2].NGFQGILITPLSIEDLFEDFCDVVVLDK.[2].RDEHIER 980  Encephalitozoon cuniculi
19173313  929 MQRVSPSPLYVLDEIDANLDVQSRERVSMLIKEMS.[2].CGNQFIITTFRKELLSCGSKYLSVEFEE.[1].RSRVKEI 1001 Encephalitozoon cuniculi
19075000  941 IQSYRPSPFRLVDEINQGMDRHNEKLVHDILVALS.[2].GNEQFFMITPKIAPGLSYSQNMKVIILY.[2].QSCAGQE 1014 Encephalitozoon cuniculi
19114172 1113 IQRCDPAPFNILDECDANLDAQYRSAIAAMVKEMS     KTSQFICTTFRPEMVKVADNFYGVMFNH.[1].VSTVESI 1183 fission yeast
8489009   971 LQGLAIAPFRIVDEINQGMDPRNERVVHRHIVNSV.[3].AVSQYFLVTPKLLPDLTYHRNLKVLCIC.[4].LPATFRT 1047 fission yeast
1709997  1060 IWEAMSCPLRCLDEFDVFMDAVNRLVSIKMMVDSA.[3].SDKQFIFITPQDMGQIGLDKDVVVFRLS.[3].VSSSALP 1135 fission yeast
730753   1100 LLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRF     KGSQFIVVSLKEGMFANANRVFRTRFQD.[1].TSVVSIM 1170 baker's yeast
1352989  1142 IQMVDPASFYLFDEIDAALDKQYRTAVATLLKELS     KNAQFICTTFRTDMLQVADKFFRVKYEN.[1].ISTVIEV 1212 baker's yeast
6324539  1002 LQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENA.[3].NTSQYFLITPKLLTGLHYHEKMRIHCVM.[4].IPNPSED 1078 baker's yeast

6323115  1410 .[9]. 1418 baker's yeast
19074461            Encephalitozoon cuniculi
19173313 1002 .[9]. 1010 Encephalitozoon cuniculi
19075000 1015 .[9]. 1023 Encephalitozoon cuniculi
19114172 1184 .[9]. 1192 fission yeast
8489009  1048 .[9]. 1056 fission yeast
1709997  1136 .[5]. 1140 fission yeast
730753              baker's yeast
1352989  1213 .[9]. 1221 baker's yeast
6324539  1079 .[9]. 1087 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap