Conserved Protein Domain Family
CcoN

?
COG3278: CcoN 
Cbb3-type cytochrome oxidase, subunit 1 [Posttranslational modification, protein turnover, chaperones]
Statistics
?
PSSM-Id: 33089
View PSSM: COG3278
Aligned: 20 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 7-Oct-2002
Updated: 7-Oct-2002
Structure
?
Aligned Rows:
COG3278 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

gi 15888860 114 .[3].AARAR.[4].YFDEVVKYGVIATVFWGVVGFLVGVVVALQLAFPDLNIA.[1].YFNFGRMRPLHTSAVIFAFGG 186
gi 17987847  56 .[3].KVDQS.[1].YMDGPIRYGVIATVFWGVVGFLVGVLIAAQLAFPDLNLQ.[1].YFNFGRLRPVHTSAVIFAFGG 125
gi 16125650  66 .[3].QDHPD.[1].YSDNVVKAGVIATMFWGAAGLLVGVIIAAQLSWPTIFYF.[4].FLNFGRLRPLHTSAVIFAFGG 138
gi 15792805   1 .[3].GNVLN     YDYTVARYFMFATILFGIVGMAIGTLIAFQMAYPNLNYL.[3].YATFSRLRPLHTSGVIFGFML 71
gi 15644773   1 .[3].NVPLS     YDYSISKLFLYAMVGFGIVGMLIGIVLAFELSFPNLNYI.[3].YGIFGRLRPLHTNAVIYGFTL 71
gi 15794862   1      METLM.[4].YNYKVVRQFAIMTVVWGIVGMLVGVIVAAQLFAPALDLS.[4].WFHFGRLRPLHTNAVIFAFGG 73
gi 15597053   1 .[3].TDSRK.[4].YNYDVVRQFTLMTLVWGILGMGLGVFIAAQLVWPALNLD.[2].WTSFGRIRPIHTSLVIFAFGG 74
gi 15599328   1 .[3].ATTEP.[1].YNYKVVRQFAIMTVVWGVIGMGLGVLIASQLVWPQMNFD.[2].WTSFGRLRPLHTNLVIFAFGG 71
gi 16262773  59 .[3].PDPSR.[3].YYDDPIKAGVWFTLFWAIFGMFIGVWAAAQLAWPSLNFD.[2].WASFGRIRPAHTTGVIFGFGG 131
gi 15611202   1 .[3].NVPLS     YDYSISKLFLYAMIAFGIIGMLIGIVLAFELSFPSLNYI.[3].YGVFGRLRPLHTNAVIYGFTL 71

gi 15888860 187 NALIATSFYVVQRTCRARLFGG     NLGWFVFWGYNLFIIMAATGYLLGITQGREYAEPEWYVDIWLTIVWVAYLATF 261
gi 17987847 126 NALICSSFYVVQRTCRARLFGG     DLAWFVFWGYQLFIVMAATGYLLGITQSREYAEPEWYVDIWLTIVWVAYLVVF 200
gi 16125650 139 NALIATSFYVVQRTCKARLAGG     ITPWFVFWGYQLFIVLAATGYLMGATSGKEYSEPEWYTDLWLTIVWVAYLLVF 213
gi 15792805  72 SGIWATWYYIGQRVLKVSMAES.[4].AVGKLHFWLYMLTMVLAVISLFMGVTTSKEYAELEWPLDILVVLVWVLWGVSI 150
gi 15644773  72 GGIWASWYYIGQRVLKITYHQH.[4].IVGLLHFWLWIILLILGVISLFAGLTQSKEYAELMWPLDIIVVVAWVLWGVNM 150
gi 15794862  74 CGLIGTSYYVVQRTCNTRLFGG     WLPAFTFWGWQAVIVAAVVSFPMGWTQGKEYAELEWPIDILITLVWVAYAIVF 148
gi 15597053  75 SALFATSFYVVQRTSGVRLISD     ALARFVFWGWQAAIVGMIVSYPLGYTTSKEYAEMEWPLALWMAIVWVVYACLF 149
gi 15599328  72 CALFATSYYTVQRTCQVRLFSD     TLAAFTFWGWQAVAVILLVSLPLGNTTTKEYAEIEFTGAIWLAIVWVAYAVVF 146
gi 16262773 132 NALIATSFHVVQRTSRARLADQ     LSPWFVLFGYNLFCILAVTGYFMGVTQSKEYAEAEWYADLWLVIVWVTYFILY 206
gi 15611202  72 GGIWASWYYIGQRVLKITYHQH.[4].IVGLLHFWLWILLLVLGVISLFAGLTQSKEYAELMWPLDIIVVVAWVLWGVNM 150

gi 15888860 262 LGTILTRKEPHIYVANWFYLSFIVTIAMLHIVNNLAVPVSFL.[2].KSYSAFSGVQDALTQWWYGHNAVGFFLTAGFLG 338
gi 17987847 201 MGTLLRRKEPHIYVANWFYLSFIITIAMLHIINNLAIPVSFL.[2].KSYSAFAGVQDAVTQWWYGHNAVAFFLTVPFLA 277
gi 16125650 214 LGTIWKRKEPHIYVANWFYLAFIVTVALLHVVNNAAVPVGLL.[2].KSYGVFAGVQDALVQWWYGHNAVGFFLTAGFLA 290
gi 15792805 151 FGLIGIRREKTLYISLWYYIATFLGIAMLYLFNNMEVPTYFV.[7].HSVSMYAGTNDALVQWWYGHNAVAFVFTVGIIA 232
gi 15644773 151 FGSMSVRRENTIYVSLWYYIATYVGIAVMYIFNNLSVPTYFV.[7].HSISMYSGSNDALIQWWWGHNAVAFVFTSGVIG 232
gi 15794862 149 FGTIAKRKIKHIYVANWFYGGFILAVALLHIVNNISIPAGLM     KSYPVYSGAIDAMVQWWYGHNAVGFFLTAGFLG 223
gi 15597053 150 FGTIARRKVKHIYVGNWFYGAFIIVTAMVHMVNHALLPVSLG     KSYSAYSGATDAMIQWWYGHSVVGFILSVGFLG 224
gi 15599328 147 FGTLIKRKVKHIYVGNWFFGSFILTTAMLHIVNHMSLPVSWF     KSYSMYSGATDAMVQWWYGHNAVGFFLTTGFLG 221
gi 16262773 207 IRTLARRREPHIYVANWYYMAFIVVVAILHIINNLTVPVSLG.[2].KSYTIWSGVQDSMVQWWYGHNAVAFFLTAGFLA 283
gi 15611202 151 FGSMSVRRENTIYVSLWYYIATYVGIAVMYIFNNLSIPTYFV.[7].HSISMYSGSNDALIQWWWGHNAVAFVFTSGVIG 232

gi 15888860 339 MMYYFIPKQVNRPVYSYRLSIIHFWALIFMYIWAGPHHLHYTALPDWAQTLGMVFSIMLWMPSWGGMINGLMTLSGAWDK 418
gi 17987847 278 MMYYFVPKQANRPVYSYRLSIVHFWSIIFLYIWAGPHHLHYTAVPDWAQTLGMVFSIMLWMPSWGGMINGLMTLSGAWDK 357
gi 16125650 291 MMYYFVPRRVERPVYSYRLSIVHFWALIFIYIWAGPHHLHYTALPQWAQTLGMTFSIMLWMPSWGGMINGLMTLSGAWDK 370
gi 15792805 233 QIYYFLPKESGQPIFSYKLSLFAFWGLMFVYLWAGGHHLIYSTVPDWMQTMGSVFSVVLILPSWGSAINILLTMKGEWSQ 312
gi 15644773 233 TIYYFLPKESGQPIFSYKLTLFSFWSLMFVYIWAGGHHLIYSTVPDWVQTLSSVFSVVLILPSWGTAINMLLTMRGQWHQ 312
gi 15794862 224 MMYYFVPKQAARPVYSYRLSVVHFWALIFTYMWAGPHHLHYTALPDWTQSLGMVLSLILFAPSWGGMINGIMTLSGAWDK 303
gi 15597053 225 MMYYFVPKQAGRPIYSYRLSIVHFWAIISIYIWAGPHHLHYTALPDWAQSLGMVMSLILLAPSWGGMINGMMTLSGAWHK 304
gi 15599328 222 MMYYFVPKQAGRPVYSYRLSIVHFWALITLYIWAGPHHLHYTALPDWAQSLGMVMSLILLAPSWGGMINGMMTLSGAWHK 301
gi 16262773 284 MLYYYLPKRAERPIFSYRLSILSFWGITFFYMWAGSHHLHYTALPHWVQNLGMTFSVMLLVPSWASAGNALLTLNGAWHK 363
gi 15611202 233 TIYYFLPKESGQPIFSYKLTLFSFWSLMFVYIWAGGHHLIYSTVPDWVQTLSSVFSVVLILPSWGTAINMLLTMRGQWHQ 312

gi 15888860 419 IRTDPIVRMMVMAVAFYGMATFEGPMMSIKAVNSLSHYTDWTIGHVHSGALGWNGMITFGAIYYLTPKLWGR.[1].RLY 494
gi 17987847 358 VRTDPIIRLMVAAIAFYGMATFEGPMLSIKAVNSLSHYTDWTIGHVHAGALGWNGMISFAAVYYLAPKLWNR.[1].RLY 433
gi 16125650 371 LRTDPVVRMMVVSIAFYGMSTFEGPVMSIRAVNALSHYTDWTIGHVHSGALGWVGFISFGAIYCLVPWLWKK.[1].GMY 446
gi 15792805 313 LRESPLIKFMILASTFYMFSTLEGPILSIKSVNALAHFTDWIPGHVHDGTLGWVGFMTMAALYHMTPRVFKR     ELY 387
gi 15644773 313 LKESPLIKFLVLASTFYMLSTLEGSIQAIKSVNALAHFTDWIIGHVHDGVLGWVGFTLIASMYHMTPRLFKR     EIY 387
gi 15794862 304 LRTDPILKFLIVSLSFYGMSTFEGPMMSIKTVNALSHYTDWTVAHVHAGALGWVGFVTIGSVYYMIPRLFGK.[1].QMH 379
gi 15597053 305 LRDDPILRFLVVSLAFYGMSTFEGPMMAIKTVNSLSHYTDWTIGHVHAGALGWVAMISIGTLYHMIPKLWGR.[1].RMH 380
gi 15599328 302 LRDDPILRFLVVSLAFYGMSTFEGPMMAIKTVNALSHYTDWTIGHVHAGALGWVAMITIGSLYHLIPKVYGV.[1].KMH 377
gi 16262773 364 VRDDATLRFIMMAAFFYGLSTFEGSFLAVRPVNSLSHYTDWTVGHVHAGALGWVALITYGSLYTLVPAIWKR.[1].RMY 439
gi 15611202 313 LKESPLIKFLVLASTFYMLSTLEGSIQAIKSVNALAHFTDWIIGHVHDGVLGWVGFTLIASMYHMTPRLFKR     EIY 387

gi 15888860 495 SLQLVNWHFWLATLGIVVYAAVMWVAGIQQALMWREYDSQGFLVYSFAESVAALFPYYVMRALGGLMFLSGALIMAYNVT 574
gi 17987847 434 SIRMVNWHFWLATLGIVLYASSMWVAGIQQGLMWREYDNQGFLVYSFAETVLAMFPYYVIRTIGGVFYLTGGLLMAWNVY 513
gi 16125650 447 SNKLIEWHFWIATTGILLYIAAMWVSGVMEGLMWREYTPQGFLAYSFIETVSAKHIENVIRTVGGLMYLSGALIMIVNMW 526
gi 15792805 388 SKSLMEAQFWIQTTGIVLYFASMWIAGITQGMMWRATDEYGNLLYSFIDTVVAIVPYYWIRAIGGLLYLIGFFMFTYNIY 467
gi 15644773 388 SGRLVDFQFWIMTLGIVLYFSSMWIAGITQGMMWRDVDQYGNLTYQFIDTVKVLIPYYNIRGVGGLMYFIGFIIFAYNIF 467
gi 15794862 380 STKLVEAHFWIATIGVVLYIAAMWIAGVMQGLMWSSLNDDGTLTYSFVESVKRTMPYYVIRFAGGLLYLSGMCIMAYNVY 459
gi 15597053 381 SVGLINAHFWLATIGTVLYIASMWVNGITQGLMWRAVNEDGTLTYSFVEALVASHPGYVVRLLGGATFASGMLLMAYNTW 460
gi 15599328 378 SVGLINAHFWLATIGTVLYIASLWVNGITQGLMWRAVNEDGTLTYSFVESLVASHPGFIVRLVGGGFFLTGMLLMSYNTW 457
gi 16262773 440 SAALVEVHFWLAFAGTVIYVFAMWNSGIIQGLMWRTYTGDGTLAYSFVDSLVAMYPYYIARAFGGLLFLIGAVVATYNIW 519
gi 15611202 388 SGRLVDFQFWIMTLGIVLYFSSMWIAGITQGMMWRDVDQYGNLTYQFIDTVKALIPYYNIRGVGGLMYFIGFIIFAYNIF 467

gi 15888860 575 MTILGHQREE.[2].SKGAAPSL.[1]. 595
gi 17987847 514 QTIRGRLRNE.[2].MGGTRPVA.[5]. 538
gi 16125650 527 KTIASPSAAP.[1].DASAAPAT.[1]. 546
gi 15792805 468 KTIACGRVLD.[2].PKSASPMA.[1]. 488
gi 15644773 468 MTITAGKKLE.[2].PNYATPMS.[1]. 488
gi 15794862 460 RTAIGGKAVD.[2].IPAVSQTQ.[2]. 481
gi 15597053 461 RTLRSAQDQR.[2].VLAAGQGA      480
gi 15599328 458 RTVRQARPEG     ILAAARMA      475
gi 16262773 520 MTVRGVPALA.[5].VPVAAPLP.[6]. 548
gi 15611202 468 MTITAGKKLE.[2].PNYATPMA.[1]. 488
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap