Conserved Protein Domain Family
COX1

?
pfam00115: COX1 (this model, PSSM-Id:249600 is obsolete and has been replaced by 306596)
Click on image for an interactive view with Cn3D
Cytochrome C and Quinol oxidase polypeptide I
Statistics
?
PSSM-Id: 249600
View PSSM: pfam00115
Aligned: 94 rows
Threshold Bit Score: 148.926
Threshold Setting Gi: 81557260
Created: 28-Mar-2013
Updated: 4-Apr-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam00115 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

2YEV_D        24 HKKIGLMYTATAFFAFALAGVFSLLIRTQLAV.[3].Q.[1].LTGE     QYNQILTLHGATMLFFFIIQAGLT 88
gi 122968079  91 SAFPVFMFIAFACLWLLVGSVAGLIASYKLHE.[1].D.[1].LVQQ.[3].TFGRIRTVHLNAVIYGWSSNAALA 156
gi 81357686   89 AARPAFVLLGFAVLWLLVASLAGLTSSIKLHE.[1].D.[1].LTQY.[3].TFGRIRSIHLNAVAYGWAPMAALG 154
gi 123753462  29 TRWPVIAFVVSGTFWLVAGSLLALIASFKFQF.[1].D.[1].WTHQ.[3].TFGRVRPAHLNTMIYGWISMAGVG 94
gi 123254518  35 GRQPVLLGFFISIVWLLIGTVMGDISSFKFDR.[1].D.[1].LSEQ.[3].TFGRIRPAHLNAMVYGWASTAMFS 100
gi 83747673   73 SAPVVFLFLCCAMVWLLVASLAGLTASVKLHE.[1].D.[1].LATV.[3].SFGRIRTIHLNAVAYGWAPMAGLA 138
gi 172063642 100 SRGPTFVFLSSSVFWLLLGSIAGLVASQKLTT.[1].D.[1].LTQS.[3].TFGRVRTAHLNMVVYGWASMAGIG 165
gi 126666409  83 SRTAVLTWLSSSIFWLVLGSFFGLVSSIKMHL.[1].E.[1].LAAS.[3].TFGRIRPAHLNAVTYGWASMAGIG 148
gi 120435753 151 LKKIVIYYIGAAIVWLVLGTLIGQYLGMKFIW.[1].E     MDNQ.[3].SFGRLRPVHTNMVFWGWSSLAMIG 215
gi 150025005 262 LTKLVLWFLGTAVFWLLIGSSIGEYVGIKFIA.[1].D     ADTY.[3].SIGRLRAVHTNLVFWAWSTIGIMG 326

2YEV_D        89 .[2].GNFVVPLMLGAR.[1].VALPRVNAFSYWAFLGAIVLALMSYFFPGG.[2].SVGWTFYY.[12].YLAAILLL 163
gi 122968079 157 .[1].ILWLLPRMLRTR     LHGGIWAMMGGSLINTGIAAGIGAIAVGWS.[1].GMEFLEIP      WQIDIFIF 216
gi 81357686  155 .[1].ALWMMPRLLKTK     LVGARFAISGALLWNLGLAVGIGCIAAGIN.[1].GMEWLEIP      WQVGTLFA 214
gi 123753462  95 .[1].SSWLWARLLKTK     LRGRGLLLLSAALWNVGVLVGTIGILAGYS.[1].AIEWVEMP      YVAFAFIV 154
gi 123254518 101 .[1].SLWLMPRLCRTQ     LRWAGAAVAGILIWTLGLVIGLVLLLAGYS.[1].GLEWLELD.[ 1].VWADPLLV 161
gi 83747673  139 .[1].AMFLLPRLLKAP     LVGARYAIVGAVLWNAGIIAGLGAISVGIS.[1].GLEWLEIP      WQVDILLV 198
gi 172063642 166 .[1].ALWMLPRLLKTQ     LTGGRYAIAGAWLWNAGLSAGIAAILSGWT.[1].GLQWLEIP      WQIGILLA 225
gi 126666409 149 .[1].ALFLIPRLFKTS     LAGGKYAVFGAVIWNIGLILGLTAIIIGLS.[1].GKEWLEFP      WQIDILFV 208
gi 120435753 216 .[1].GYFVIARTSNTI     IHSYKWAWRAWVFINSSVILGSIFLMAGIN.[2].GGEYREYI      WPVMLLFA 276
gi 150025005 327 .[1].GYYIVPMVSNTP     LNNIKNGWKALIAVNLAMFVGAITLMAGIN.[2].GGEYREII      WPIMAVWA 387

2YEV_D       164 .[1].FSSLLGNANFVATIYNLRAQGMSLW.[5].VWSVFAASVLNLFSLAGLTA.[22].DPVLFQQFFWFYSHPTVYV 255
gi 122968079 217      VGFALVILPALYTLVNRRIEHLYVS     VWYFTAALLWIAVLFGVANL.[ 4].TGVQQATTNWWYGHNALGL 284
gi 81357686  215      VGGALIGLPLVFTLRHRQVEHLYVS     VWYMGAALFWFPVLYIVAKL.[ 4].FGVEQATMNWWFGHNVLGL 282
gi 123753462 155      PAMGLLVVSFVRTLWHRHARHLYIS     VWYLGAAILWGPLLVIAILL.[ 3].SGVPEATANWWYAHNILGL 221
gi 123254518 162      VGASLVGASIWKTLSVRNVHHLYVS     VWYVAASYPWFAIIFIAGNL.[ 3].QGVESAAVNWFYAHNALGL 228
gi 83747673  199      LGGALVAMPLVLTLVNRRVEHLYVS     VWYMGCALFWFPVLFLVANI.[ 4].FGVEQATMNWWFGHNVLGL 266
gi 172063642 226      AGGALAAVPLLMTIARRTTRHLYVS     VWYLAAALLWFPILYIVAKV.[ 4].FGVEQAIVNWWFAHNVLGL 293
gi 126666409 209      VGGGLCAIPLLLTAANRQVEHLYVS     SWYLMAALVWFPILFLIANL.[ 4].PGASGATVNWWFAHNVLGL 276
gi 120435753 277      IALVITFFNFYKTVANRKISEIYIS     NWFILASLIWTIVLAVIGYL.[ 4].DGLGETVIQGYYMHQGVGM 344
gi 150025005 388      YGLLLTVTNFIKTIAKRTTHEIYIS     NWFIVASYIFILIVAFLSYI.[ 4].DGIGETIVQGYYMHQAVGM 455

2YEV_D       256 MLLP     YLGILAEVASTFARKPLFGYRQMVWAQMGIVVLGTMVWAHHMFTVGESTLFQIAFAFFTALIAVPTGVKLF 330
gi 122968079 285 WFTP.[1].AVGAIYYFLPKIIGRPVVSYNLSLLGFWTLAFFYGQVGGHHLIGGPVPGWLTTLSIVQSVMMIIPVLAFTI 360
gi 81357686  283 FYTP.[1].SLAAVYYLLPKVIGRPIQSYNLSLIGFWCLAFFYGQVGGHHLVGGPVPEWLITLSIVQSVMMIIPVVAFSV 358
gi 123753462 222 WITP.[1].GLAAAYYLIPKVIGRPVHSYHLSYLGFWTLALFYNWAGVHHLVGGPAPQWVATVSIVFSAMMIIPVIVVAV 297
gi 123254518 229 WLTT.[1].NLGLIYYLLPKIIGRPIYSYWLSLIGFWGLALFYALNGMHHLIGGPLPSWMIATSITASIMMVIPVVAVGI 304
gi 83747673  267 FYTP.[1].ALASVYYFLPKIIGRPVQSYGLSLLGFWALAFFYGQVGGHHLVGGPVPGWLITLSIVQSMMMLVPVIAFSI 342
gi 172063642 294 WLTP.[1].GLAAAYYFIAKVLGRPIYSYALSLVGFWALAMFYSQAGIHHLLGGPVPQWLQSVSVVQSVMMIVPVLAVGV 369
gi 126666409 277 WVTP.[1].GIGIAYYMIPKILGRPIISYQLSLIGFWSLALFYSQVGIHHIIGGPIPTWLVTLSIVHSVMMSIPVITVAI 352
gi 120435753 345 WFMT.[1].TLGLVYYYLPSALNKPIYSYSLGVLAFWTQMLFYTMIGTHHFVFSPLPWWLQTTAIVFSAGMFIPVVAGTT 420
gi 150025005 456 WFMF.[1].MLGILYYILPQQVNKPIYSYSLGVLAFWSQILFYTTIGTHHFVFSSLPWWLQTVAIIGSVGMLIPVTSGTI 531

2YEV_D       331 NIIGT.[5].LQMKTPLYWVLGFIFNFLLGGITGVMLSMTPLDYQFHDSYFVVAHFHNVLMAGSGFGAFAGLYYWWPKMT 410
gi 122968079 361 NMKGT.[7].ARYSPTLRFMMFGGLMYLASSVQGSFEALRSINAVTHFTHFTVAHAHLGMYAFVTMVFFGAIYFMMPRVL 442
gi 81357686  359 NQHLT.[7].LRHSPTLRFVVLGGMMYTLSSIQGSFEALRSVSTVTHFTHFTVAHAHLGLYGFVTLVMFGAIYFAMPRIV 440
gi 123753462 298 NHHLT.[7].LKYSPTLRFVVFGAMSYTAVSLQGSLQSFRYWQEVTHFTHYTIAHAHLGVYAFATMIAFGAIYYIMPRVT 379
gi 123254518 305 NHHMT.[7].MRYSPALTLAVIAAMSYTAVSLQGILTALVSVNRITHFTHWTIAHSHLGLYMFVTLSLFGGMYYILPRVL 386
gi 83747673  343 NQHQT.[7].LIDSPTLRFVTLGGMMYTLSSIQGSFEALRSVNVVTHFTHFTVAHAHLGLYGFVSLVFFGSIYFIVPRVV 424
gi 172063642 370 NHHMT.[7].LKHSPTLRFVVLGAVLYTLVSLQGSLEALPFFNRLVHFTQYKVAHAHLGLYGFFSMIMFGSIYFTMPRVL 451
gi 126666409 353 NHHGT.[7].LKDSPTLRFVWIGALMYTVASLQGSMEALRSVNVITHFTHYTIAHAHLGMYAFLSFILFGAIYFIMPRLT 434
gi 120435753 421 NFLMT.[7].ISKSYVLPFFLVGTLFYFVGSTQGSFQAFRFTNYVWHFTDFNVAHSHMTMYGIIAFFLWAAIYAILPKLT 502
gi 150025005 532 NYLMT.[7].VSNSYSLPFLLVGVVYYFTGSFQGTAEAFRSTNLIWHFTDFTIAHSHITMYGIITFLLFGSIYAIVPRLT 613

2YEV_D       411 GR     MYDERLGRLHFWLFLVGYLLTFLPQYALGYL     GMPRRY.[1].TY.[3].IAG.[4].NLLSTIGAYIL 473
gi 122968079 443 EW.[1].WPYPWLITLHFWLAALGISIYFVGLTIGGWL.[1].GTAMLD.[1].AR.[3].ESV.[6].LKSRSVGGLVM 509
gi 81357686  441 SR.[1].WPYPKLIALHFWLVTIGFAIYFVTLTIGGVL.[1].GLSMLD.[1].SQ.[3].ESV.[6].LQGRSIGGALM 507
gi 123753462 380 NW.[1].WGSKRLVSLHFWTTGLGIGAYVTALTIGGVI.[1].GLQLLD.[1].DV.[3].TIV.[6].LVVRSVSGTLM 446
gi 123254518 387 KK.[1].WPSTRLIRMHILLTGGGMVLYVVVLGIGGVL.[1].GLSLLA.[1].GQ.[3].ASV.[6].LLLRSVAAVII 453
gi 83747673  425 GR.[1].WPYRWMIYGHFWLATIGIGIYFVALTIGGTL.[1].GLAMLD.[1].GR.[3].DSV.[6].LKARSVGGALM 491
gi 172063642 452 ER.[1].WPYPKLVWLHFWLAAVGFAIYFVSLTIGGVL.[1].GIALLD.[1].AR.[3].ASV.[6].LQARTLGGALM 518
gi 126666409 435 NW.[1].WPWRGLISLHFWLVSVGIVIYVVSLSIAGWK.[1].GVALLD.[1].AM.[3].DIV.[6].LQARTVGGALM 501
gi 120435753 503 GK     EPPQVLVGAHFWMAFIGLFAYMVSLMVGGTY.[1].GLSWIE     GN.[3].ESV.[6].WVWRAIGGSLM 567
gi 150025005 614 GQ     EPPQLGVGAHFWLALIGLQFYTIPLMIGGTL.[1].GLMWAE     GK.[3].DSV.[6].WLWRAIGGSLM 678
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap