Conserved Protein Domain Family
mutL

?
PRK00095: mutL 
DNA mismatch repair protein; Reviewed
Statistics
?
PSSM-Id: 234630
View PSSM: PRK00095
Aligned: 563 rows
Threshold Bit Score: 495.891
Threshold Setting Gi: 22300008
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

PRK00095 is a member of the superfamily cl28386.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

gi 54310432    1 MPIQILPARLANQIAAGEVVERPASVVKELVENSLDAGATRIDIDIDRGGSRTIRIRDNGKGIAKDELGLALSRHATSKI 80
gi 222056190   3 TRIKILPEQLTNKIAAGEVVERPASVVKELVENALDAGCSEVMVEIEAGGKRLIRVSDTGCGMTREDALLALERHATSKI 82
gi 253701877   3 TKIRILPENLTNKIAAGEVVERPASVAKELVENALDAGSKEVVVEIESGGRRLIKVSDTGCGMSRDDALLALERHATSKI 82
gi 78223260   31 TQIRILPENLTNKIAAGEVVERPASVVKELVENSLDAGCRDIIVEIEAGGRRLIRVTDDGSGMSREDALLSLERHATSKI 110
gi 39997099    3 HRIRILPEILTNKIAAGEVVERPASVVKELVENALDAGCGEIIVEIEGGGRRLIRITDDGCGMSREDALMALERHATSKI 82
gi 197117368   3 TKIRILPENLTNKIAAGEVVERPASVAKELVENALDAGSKEVVVEIESGGRRLIKVSDTGCGMSRDDALLALERHATSKI 82
gi 148263827   3 TRIKILPENLTNKIAAGEVVERPASVVKELVENALDAGCSEVVVEIEAGGRRLIKVTDSGCGMTREDALLALERHATSKI 82
gi 153004950   2 PRIQVLPPGLVNQIAAGEVVERPASVVKELVENALDAGATSVSIDVEEGGLALVRVADDGCGMSADDAQLALERHATSKL 81
gi 197122538   2 PRIHVLPPGLVNQIAAGEVVERPASIVKELVENALDAGATSVGVDVEEGGLALVRVADDGSGMDRDDALLALERHATSKL 81
gi 220917323   2 PRIHVLPPGLVNQIAAGEVVERPASIVKELVENALDAGATSVGVDVEEGGLALVRVADDGSGMDRDDALLALERHATSKL 81

gi 54310432   81 SSL.[1].DLEAIVSLGFRGEALASISSVSRLTLTSRTATQEEAWSA     YAEG.[2].MDVQLKPAAHPIGTTIEVL 148
gi 222056190  83 AND.[1].DLFSLATLGFRGEALPSVASVSRFTLATREKGSLEGTEI.[1].AEGG     RIKEVKACGMAEGTVISVR 149
gi 253701877  83 ATD.[1].DLFSLCTLGFRGEALPSVASVSRLTISTRTSDSVEGTEI.[1].AEGG     RIKEVKECGMAVGTVISVR 149
gi 78223260  111 ASD.[1].DLFSLCTLGFRGEALPSIASVSRFSLATRQRGAIEGTEI.[1].AEGG     RIKEVKACGMAEGTVITVR 177
gi 39997099   83 ATD.[1].DLFSLATLGFRGEALPSVASVSRFTLATRERGSIEGTEI.[1].AEGG     KIREVKACGMAEGTVVSVR 149
gi 197117368  83 ATD.[1].DLFSLCTLGFRGEALPSVASVSRLTISTRTSDSVEGTEI.[1].AEGG     RIKEVKECGMAVGTVISVR 149
gi 148263827  83 ASD.[1].DLFGLATLGFRGEALPSIASVSRFALATREKGAIEGTEI.[1].AEGG     RVKEVKVCGMAEGTVISVR 149
gi 153004950  82 RDA.[1].GLAAIATMGFRGEALPAIASVARFRLDTAPAEDGAGTRV.[1].VEGG     GRPSSGPVARPRGTTIEVR 148
gi 197122538  82 RDA.[1].GLAAIGTMGFRGEAVPAIASVSRFRLDTSAGEDGAGTRV.[1].IEGG     VLGEVAPVARPRGTTVEVR 148
gi 220917323  82 RDA.[1].GLAAIGTMGFRGEAVPAIASVSRFRLDTSAGEDGAGTRV.[1].IEGG     VLGEVAPVARPRGTTVEVR 148

gi 54310432  149 DLFFNTPARRKFLRTEKTEFNHIDELLKRIALSRFDVSITLRHNGKTIRQYRA.[4].IQKERRLVSACGQSFLQHALAV 227
gi 222056190 150 NLFFNTPARLKFMKSSETEAGHVGDLLTRLAISRPDIRFIYTNDGKTVFRALN     ADLRERVATLLGRTLSQDLYPL 224
gi 253701877 150 NLFFNTPARLKFMKSAETEGGHVGELLTRLAISRPEVRFTYKNDGKVMFRALD     ADLKERVATMLGRSISSFLYPV 224
gi 78223260  178 NLFFNTPARLKFMKSAETEAGHVGDLLTRLAISRPEVRFTYVNDGKTVFRALN     GTMEERVAALLGRTIAGALYPL 252
gi 39997099  150 NLFFNTPARLKFMKSVETEGGHVADLVTRLALSRPEVRFTCVSDGKTLFRALD     GTLLDRVAALLGKTVASALHPV 224
gi 197117368 150 NLFFNTPARLKFMKSAETEGGHVGELLTRLAISRPEVRFTYKNDGKVVFRALD     ADLKERVATMLGRSIASFLYPV 224
gi 148263827 150 NLFFNTPARLKFMKSSDTEAGHVGDLLTKLAISRPDVRFIYNNDGRTIFRALD     ADLRERVATLLGRALSADLYPL 224
gi 153004950 149 DLFFNTPARRKFMRAAATESGHVTEAVVRLALARPDVGFTLRSAGRLVLGSRA.[1].AAAADRAAQALGRDAHRHLVPV 224
gi 197122538 149 DLFFNTPARRKFMRAASTEAGHVSEAVIRLALARPDVGFTLRSGGRLVLGARA.[1].GGLADRAGQALGREAHRHLLPV 224
gi 220917323 149 DLFFNTPARRKFMRAASTEAGHVSEAVIRLALARPDVGFTLRSAGRLVLGARA.[1].GGLADRAGQALGREAHRHLLPV 224

gi 54310432  228 ELEHGDLNLSGWICTPQGSRSQNDVQYCYVNGRMMKDKLINHAIRQAYEANLASDQYSAYVLFIEVDPHQVDVNVHPAKH 307
gi 222056190 225 DFCDGQLNVTGLVGKPECSRSAASHVYTYINGRFIRDKVVQHAVLQAYRNFMERGRYPVVVLFISVPAAEVDVNVHPTKH 304
gi 253701877 225 SYQEGGLKVSGLVAAPECSRSAGSHLYTYINGRFIKDKVVQHAILQAYRNFLERGRYPVVAVFIDIAPGEVDVNVHPTKH 304
gi 78223260  253 DSTVEGVTVRGLVARPDVSRSAAGHLYTFINGRFIRDRVVQHAVLQAYRNFLERGRYPVVVLFIQVPAGDVDVNVHPTKH 332
gi 39997099  225 DLATEGVRVTGLVARPDVSRSAASHLYTYINGRFIRDRVVQHAILQAYRNFLERGRYPVVVLFIEVSPGEVDVNVHPTKH 304
gi 197117368 225 SYQEGGLKVSGLVAAPECSRSAGSHLYTYINGRFIKDKVVQHAILQAYRNFLERGRYPVVAVFIEIAPGEVDVNVHPTKH 304
gi 148263827 225 DFHDGPLGVTGLIAKPECSRSAASHLYTYINGRFIKDKVVQHAVLQAYRNFMERGRYPVVVLFITVPADEVDVNVHPTKH 304
gi 153004950 225 DAGRGNVRVRGLVCSPDHSEATGRALYLFVNGRYVRDRGAAHAVLRAFAGTLPPGRHPAGVLFVELPLDRVDVNVHPQKL 304
gi 197122538 225 DARRGEVRVHGLICSPDHSEATGRALYLFVNGRYVRDRAAAHAVLRAFAGTLPPGRHPAGVLFVELPLHRVDVNVHPQKL 304
gi 220917323 225 DARRGEVRVHGLICSPDHSEATGRALYLFVNGRYVRDRAAAHAVLRAFAGTLPPGRHPAGVLFVELPLHRVDVNVHPQKL 304

gi 54310432  308 EVRFHQARLVHDFIYQGIQSALQQGAMDDQ.[19].ASESMESAHSHQIAEAAPALQAIAD.[114].SSLGSPAKASTT 507
gi 222056190 305 EVRFREQGRVHDAIQEAVESVLRSSPWVKT.[14].AARIAQVRESLTQYRPQKTTQQSFK.[  1].STPAVPASFRET 386
gi 253701877 305 EVRFREQGRVHDAIQKAVESVLKETPWLKR.[26].QAALPVTPQPRPALTPGHPDPPPQA.[ 35].GSVAPREGSPYA 432
gi 78223260  333 EVRFRQQGVVHDVIQGVIEEALRPTPWLRK      ESQSTVSSPPPERREPATSSERVAE.[ 11].PAPSRPFFQPLP 410
gi 39997099  305 EVRFRQQGIVHDVIQGAVEETLRLTPWIRR.[ 9].AVPRPQQYVQGTGARQVEEVRELLE.[ 13].APQPAPQPDREP 393
gi 197117368 305 EVRFREQGRVHDAIQNAVESVLKETPWLKR.[28].PVTPQPRPALTSEKPVPAPQAQPQQ.[ 35].SKEALPYAPMAA 434
gi 148263827 305 EVRFREQGRVHDAIQAALESVLRATPWVRK.[14].EASATRVAEVRETLARYSPEKHLQQ.[  5].PAATFQRQQGAV 390
gi 153004950 305 EVRFAEAREVYDALFHAIAGTLRTAPWLAH.[12].ALTPPGGAGSDETAAVLAWAREAHA.[  4].GALVPPPSPVPG 387
gi 197122538 305 EVRFAEGREVFDALFHTVAGALRTAPWLRA.[22].GEEAAEVLAWARAARPPEGSGATLV       QPAPGAWATGRL 393
gi 220917323 305 EVRFAEGREVFDALFHTVAGALRTAPWLRA.[22].GEEAAEVLAWARAARPPEGSGATLV       QPAPGAWATGRL 393

gi 54310432  508 LTGESRSTAVTRQNVVDTQVGVGLGK     ALSIVAERYLLVSRHDG     IHVLSLDHAQRLHHKGQLRLAATE 574
gi 222056190 387 SLPDPVPVADAAPAPEVERGYFSGLS     VIGQFNAAYILCQDGNS     LVIIDQHAAHERVAFERLKTQHAA 453
gi 253701877 433 PIAAAPVPASEPQSAAQDSDHVAAGY.[5].VIGQFNASYILCQRGTD     LILIDQHAAHERVAFEKLKGQFAG 504
gi 78223260  411 AVVPAPDQSAEEPDRPMDRGYFSRLA     IIGQFHASYILCQDGSD     LVIIDQHAAHERVAFERLKAQFAA 477
gi 39997099  394 PLPDSGSRMLDDTAVRRHGGYFSSLA     VIGQYNASYILCQDGSD     LVIIDQHAAHERVAFERLKTQFAA 460
gi 197117368 435 PVPVREPETAAPEPDPAAAGYFSSLG     VIGQFNASYILCQRGTD     LVLIDQHAAHERVAFEKLKGQFAG 501
gi 148263827 391 SLPVAAREDDTASDKTESKGYYCSLS     VIGQFNAAYILCQDGTD     LVIIDQHAAHERVAFEKLKAQFAA 457
gi 153004950 388 ASGTFAFAIPDEAGLARPAGYFASLR     YVGQHARTYLLCEAQGG.[1].LVVIDQHASHERLLFQRLREVFRT 455
gi 197122538 394 AFPVVPAPGAGPEAGPRPEGYFAGLR     YVGQHARTYLLCEAPGG.[1].LVVIDQHASHERMLFHRLREAFRA 461
gi 220917323 394 AFPVAPAPGAGPEAGPRPEGYFAALR     YVGQHARTYLLCEAPGG.[1].LVVIDQHASHERMLFHRLREAFRA 461

gi 54310432  575      GLKPQPLLIPHSVPVEPDLITCAEQHALLLKQLGINLKAKGKSGLIILSVCLPLRQQNLQQLIPNLLTYLLSIAE 649
gi 222056190 454 .[1].GVESQRLLFPETVEFSFKEGAVIREHQTELDRVGFSLEEFGGSTWLLNAVPHLLSGNDYVKTLRDILEELQSLGR 529
gi 253701877 505 .[1].EVDSQGLLFPETMEFSFRESAVLREHQAELARLGFEFEEFGGNTWLLKGVPQVLSATRYVDTIRDILEELGSLSR 580
gi 78223260  478 .[1].GVEGQGLLFPDTLELSHREVAELREHGEELRRIGFDLDEFGGTTWVVKGVPRLLAGKDYLRILRDTLEEFQAVGA 553
gi 39997099  461 .[1].RVEGQGLLFPETVELSHRESAVVREHGGELGRLGFDLEDFGGTTWIVKGIPRLLAGTDYLRLLRDTLEELQSLGA 536
gi 197117368 502 .[1].EVDSQGLLFPETMEFSFRESAVLREHLAELARLGFEFEEFGGNTWLLKGVPQVLSATRYVDTIRDILEELGSLSR 577
gi 148263827 458 .[1].QVESQRLLFPETIELSFKEGATLREHLAELGRLGFSLEEFGGATWLLNAVPRLLSGTDYLRTLRDILEELQTLGR 533
gi 153004950 456 .[1].KLPVQPFLLPQVVTLPPAVARALEGGLPELARLGFDVEPFGGDSFAVKGAPAALAGVDLEALLLDLSAQLELVGS 531
gi 197122538 462 .[1].RIPVQPFLLPQVVTLPPAAARALEAGLAELGRLGFDAEPFGGEAFAVKGAPAALAGVDLTALLTDLGSQLAEVER 537
gi 220917323 462 .[1].RIPVQPFLLPQVVTLPPAAARALEAGLAELGRLGFDAEPFGGEAFAVKGAPAALAGVDLTALLTDLGSQLAEVER 537

gi 54310432  650 DPDAQ.[4].LWDWLATQCVMPVDTFSLSQAIQLVTELEQLWGSDIEQHNQYLLRPVDVSTAIEAFLY.[1]. 717
gi 222056190 530 SRSFQ.[6].LARIACHSVVRGSHCLSQQEIKALFQQMDTTEFSSNCPHGRPVLHTLTLAEIERMFKR      598
gi 253701877 581 SRAFS.[6].LARIACHSVVRGKRTLSPVEIAALFKQMDETDFSSNCPHGRPVMQTLTLAEVEKMFKR.[1]. 650
gi 78223260  554 NRSVA.[6].LTRIACHSVVRGEHPLTTAQIEALFAQMDATDYSTNCPHGRPVLQRLTLAEVERMFKR      622
gi 39997099  537 SRSIA.[6].LTRVACHSVVRGEHPLTTGEIEALFAHMDATDFSTNCPHGRPVLQRLTLGEVEKMFKR.[1]. 606
gi 197117368 578 SRAFS.[6].LARIACHSVVRGKRTLSQVEITALFKQMDETDFSSNCPHGRPVMQTLTLAEVEKMFKR.[1]. 647
gi 148263827 534 SRTFA.[6].LSRIACHSVVRGIHPLNGQEISALFAQMDATEFSSNCPHGRPVLRSLTLPEIERMFKR      602
gi 153004950 532 GTAVD.[6].LATMACHAAVRANQEVAPEEARALLDGLDAIDFKARCPHGRPVVFELPLAELERRVGR.[1]. 601
gi 197122538 538 GSAVD.[6].LATMACHAAVRANQDVSPEEARALLDGLDAIDFKARCPHGRPVVFELSLADLERRVGR.[1]. 607
gi 220917323 538 GSAVD.[6].LATMACHAAVRANQDVSPEEARALLDGLDAIDFKARCPHGRPVVFELSLADLERRVGR.[1]. 607
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap