Conserved Protein Domain Family
PRK15076

?
PRK15076: PRK15076 
alpha-galactosidase; Provisional
Statistics
?
PSSM-Id: 185035
View PSSM: PRK15076
Aligned: 141 rows
Threshold Bit Score: 628.787
Threshold Setting Gi: 256393831
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PRK15076 is a member of the superfamily cl26411.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:

gi 148657004   2 PPKIVFIGAGSTVFARNLMGDILSFPELADATLTLFDIDPERLRTSEIVAHKVAAALDARPTIEATTDRRRALDGADYAI 81
gi 222106224   3 SFKIAIIGAGSVGFTKKLFADLLSVPEFHDVEFALTDISQHNLDMIKTILDRIVEANRLPAKVTASTDRRDAISGARYII 82
gi 220928435   2 SFKVAFIGAGSLVFTRTLFTDIMSVPEFRDIKIAFTDINGDNLQKVAELCQRDLEANGITTKIQATTDRREAFKDAKYIV 81
gi 167624350   1 MTKITIIGAGSVMFTRQLVSALLSYPALQKMHLELMDLNPQVLARSEKLITLMVAQAKVPVTVSATTDRKQALIGADFVL 80
gi 238921279   1 MSKITLIGAGSIMFSRQIISALLSSPVLAGSEIILMDLDEQVLARSQRLIGMMVAQSGVPVTVRHTTDRRSALRGADFVI 80
gi 251798637   2 SFKVAFVGAGSIGFTRGLMRDLLAVPEFKDIQVAFTDINEHNLDMVTQLVQRDINENGLSIEIQATTNRREALKDARYVF 81
gi 261405222   2 SFKVAFIGAGSIGFTRGILRDLLTVPEFRDIEVAFTDISRHNLEMVTELCQRDINENGLSIAIQSTTDRRQALQDAKYVI 81
gi 302875615   2 SFKVTFIGAGSIGFTRGLLRDILSVKEFSDIKVSFTDISEENLDMVTKLCQRDIDENDLNIKIEATTNRREALKEAKYVF 81
gi 54301698    1 MTQITIIGAGSVMFTRQITSALLSYPALNDIDLVLMDIDPEVLKRSHQLISKMAEQANTHARISMTTNRRQALTGADFVI 80
gi 56962192    2 PFKVAFIGAGSIGFTRMLLRDLLSVPAFSTIEVAFTDINQENLNMVTQLCQRDINENGLPIQIHATLDRREALTGARYIF 81

gi 148657004  82 CMIQVGGYKPAT.[2].DFEIPKKYGLRQTIADTLGIGGIMRGLRTIPVLLSMCRDMEEVC     PDVTFLQYVNPMAI 153
gi 222106224  83 SCVRVGGLGAYA.[1].DISIPLKYGVDQCVGDTICAGGILYGQRNIPVILDFCKDIRELA.[1].PGAKFLNYANPMAM 154
gi 220928435  82 NCVRIGGLEAFE.[1].DIDIPLKYGVDQCVGDTLCTGGIMYGQRVIAAMLDFCKDIREVS.[1].PGAILLNYSNPNAM 153
gi 167624350  81 NLIQVGGLEPWR.[1].DIEIPAKYGVIQEVGDTMGPGGIFRALRHIPPMVEILKDMEQVC     PNALFINYANPLAP 151
gi 238921279  81 NAIQVGGLAPWR.[1].DMEIPARYGVIQEVGDTLGPGGIFRALRHIPPMLDILRDMEDLC     PQALFINYANPLAP 151
gi 251798637  82 CVVRIGGLEAFQ.[1].DIDIPLKYGIDQCVGDTLCAGGIMYGQRGIAEMLNICKDIREVA.[1].PNALLLNYANPMAM 153
gi 261405222  82 CTIRVGGLEAFR.[1].DVDIPLKYGIDQCVGDTLCAGGIMYGQRGIPEMLNICRDIREVC.[1].PDVLLLNYSNPMAM 153
gi 302875615  82 NVVRIGGLDAFK.[1].DVDIPLKYGIDQCVGDTLCAGGIMYGQRGIAAILDFCKDIREVA.[1].PDCIMLNYANPNAM 153
gi 54301698   81 NAIQVGGLEPWR.[1].DMQIPTKYGVIQEVGDTMGPGGIFRALRHIPPMLAILRDMEEVC     PEALFINYANPLAP 151
gi 56962192   82 NVVRVGGLEAFE.[1].DIDIPLRYGIDQCVGDTLSAGGIMYGQRGINEMLAICEDIRDVA.[1].QDCLLLNYANPMAM 153

gi 148657004 154 NCWAISRASRIKTVGLCHSVQGTAEQLAHDIGVP      VEEINYICAGINHMAFYLRFERNGED     LYPLIRKVY 222
gi 222106224 155 NTWAAIEYGKVDTIGLCHGVQHGAEQIAEILGAD      PVELDYICSGINHQTWFVDVRVKGRK.[5].LIDAFEAHP 228
gi 220928435 154 ATWACNKYGGVRTIGLCHGEIHGEDQIAQVLGIP      RNELDIICAGINHQTWYISVKHKGKE.[4].ILPGFEAHP 226
gi 167624350 152 LTWAAKEFSTIKSVGLCYGVRYTVAQLAGYLGLG.[20].PGEIDYEFAGINHMTWITKLTVDGED     KLADIQRIV 240
gi 238921279 152 LTWAAKEASGVRSIGLCYGVRYTVAQLVGYLGLG.[20].PADIAYEFAGINHMTWITALSRHGED     LLPRVRALA 240
gi 251798637 154 LTWACNKYGGVRTIGLCHGVQGGHHQIARALGRE      KKDVDIICAGINHQTWYISVKTDGVD.[4].LLEAFESVP 226
gi 261405222 154 LTWACNRYGGVRTVGLCHGVQHGHHQIAEVYGLK      KQDVDIVCAGINHQTWYIQASHQGKD.[4].LLEAFERHP 226
gi 302875615 154 ITWACNKYGKVHTIGLCHGVQGGHHQIAEVLGLK      QEEVDIICAGINHQTWYIQVTHKGQD.[4].LLEAFEKHP 226
gi 54301698  152 LTWAAKDSSPIKSIGLCYGVRYTAAQLVGYLGEG.[20].PSHIDYEFAGINHMTWITKMMANGKD     MQPKIRELF 240
gi 56962192  154 LTWACNHYGGVNTVGLCHGVQGGHRQIADVFGLQ      PEEVDIVCAGINHQTWYIQIKHDGED     LTGKLLEAF 222

gi 148657004 223 DEGR.[3].WNRVRYEVFRRLSYFVTESSEHFSEYTPWFIK.[2].RPDLIER     FNIPLDEYIRRCEVQLAGWEFV 292
gi 222106224 229 VFSQ     QEKLRIDVLKRFGVYSTESNGHLSEYLPWYRK     RPEEITR.[7].IHGETGGYLRYSTETRNWFETE 300
gi 220928435 227 KFSE     EEKVRIDVLKRFGYYSTESNGHLSEYVAWYRK     RPQEIMK.[7].INGETGGYLRITREERNWFETD 298
gi 167624350 241 DDPK.[3].ADGVRCEVLKFFGHWCTENHWHCSDYLPYFRK     NEAMINE     FLPNRWNLLALEEKVHAAGKLE 308
gi 238921279 241 DDAR.[3].ADGVRCEVLRFFGLWCTENHWHCSDYLPYFRK     NPQMIDR     FLPQRWNLLALEEQVHAAGQAE 308
gi 251798637 227 EFAQ     TEKVRIDMLRRFGYYSTESNGHLSEYVPWYRK     RADEIKD.[7].INGETGGYLRVCTEGRNWFETD 298
gi 261405222 227 EYSR     TEKVRIDMLRRFGYYSTESNGHLSEYVPWYRK     RPEEITE.[7].INGETGGYLRVCTEGRNWFETD 298
gi 302875615 227 EYSK     TEKVRIDMLRRFGYYSTESNGHLSEYVPWYRK     RLDEIKD.[7].INGETGGYLRVCTEGRNWFETD 298
gi 54301698  241 NNQK.[3].ADGVRCEVLKFFGLWCTENHWHCSDYLPYFRK     NEEMINH     FLPQRWDLLALEEKVHSAGEAE 308
gi 56962192  223 ENHP.[4].TEKVRIDMLKRFGYYSTESNGHLSEYVPWYRK     RQEEIGD.[7].INGETGGYLRVCKEGRNWFKED 298

gi 148657004 293 QYK     LDHPEAT.[33].E.[3].VVRSHEYGSLIIHSMETGQPRVIYGNVPND     G     LIDNLPQGCCVE 382
gi 222106224 301 FPQ     FLESAGK      P.[3].AKRSNEHASHILEALETGRVYRGHFNVKNN     G     IITNLPLDAIIE 357
gi 220928435 299 YPK     ILAEPPK      K.[3].SSRGREHCSYIIESLETGRKYRGHFNVMNE     G     CITNLPYESVVE 355
gi 167624350 309 VDA.[1].LAGEKDF      V     IAPNMLNAPKLINAIVSGERTRINGNVANQ.[1].Q.[3].LIDNLPQNCVVE 367
gi 238921279 309 IDA.[1].LAGERPF      V     IAPNMLNAPKLISAQLSGERIRINGNMANR.[1].P.[3].LVENLPAECVVE 367
gi 251798637 299 FPN     WMKAEPF      K.[3].ENRGEEHGSYIIEGLETGRVYRGHFNVVNN     G     VITNLPDDAIIE 355
gi 261405222 299 FPN     WMKDPAM      E.[3].EHRGEEHGSYIIEGLETGRVYRGHFNVVNE     G     IIANLPEDAVIE 355
gi 302875615 299 FPN     WMKEPSF      V.[3].ENRSHEHGSYIIEGLETGRIYRGHFNVINN     G     TITNLPADAIVE 355
gi 54301698  309 IDA.[1].LAGIQKF      T     IEPNMLNAPKLINAMVSGERTRINGNVPNR.[1].S.[3].LIDNLPENCVVE 367
gi 56962192  299 FPN     WMNEPAF      V.[3].SERGQEHGSYIVEALETGRIYRGHFNVVNQ     N     VISNLPSDCIIE 355

gi 148657004 383 VPCLVDKNGVQPTKIGALPPHLAALMQTNINVQALTVEAALTGKREHIYHAAMLDPHTAAELDLDQIWALVDDLIAAHGD 462
gi 222106224 358 SPGFVDRFGINMVAGITLPEACAATCISSINVQRMSVHAAISGDIDLLKLAVLHDPLVGAICTPEEVWQMVDEMVVAQAE 437
gi 220928435 356 VPCYVDGNGISVPKVGDLPLGCAAVCSQSIWVQRLAVEAAVSGNVTLLKQAALMDPLTGAVCNPPEIWQMIDEMLIAQEK 435
gi 167624350 368 VPIWADSKGLHPQPMGRLPTQCASLIKTNTAVQELIVEAALNRDLDAARYALSLDPVTATVCTLEQIDAMFKEMVEAQKQ 447
gi 238921279 368 VPVWVDGDGLHPQTMGRLPTQCASLCKSNIAVQELVVQAALTGDLDAARYALSLDPLTAAVCTLDQIQSMFDALFAAQRQ 447
gi 251798637 356 APGYVDRNGINMPVVGDLPLGPAAVCNVSISVQRMAVEAAVHGDDKLLRQAMMMDPLTGAVCNPKEIWQMVDELLVAQAK 435
gi 261405222 356 APGYVDRNGISMPLVGNLPLGPAAVCSVSISVQRLAVEAAVHGDDKLLRQAFMMDPLVGAVCNPKEIWQLVDEMLVAGEA 435
gi 302875615 356 VPGYVDKNGINIPRVGDLPLGCAAVCNNSISVQRMAVEAAVKGDDLLLRQSMMLDPLVGAVCNPPEIWQLVDEILVAQEQ 435
gi 54301698  368 VPIWVDSQGIHPQKMGRLPMQCASLIKTNTAVQELIVEAALTCDLDAARYALALDPVTATVCTLEQIDAMFTEMFTAQRQ 447
gi 56962192  356 APGYVDRNGINMPVIGDLPIGCASVCNVSINVQRLAVEAAVAGDDQLLRQAFMMDPLTGAVCTPPEIWQLVDDMLIAQEK 435

gi 148657004 463 WLPVYH 468
gi 222106224 438 WLPQYA 443
gi 220928435 436 WLPQYV 441
gi 167624350 448 WLPEFN 453
gi 238921279 448 WLPQFD 453
gi 251798637 436 WLPQYT 441
gi 261405222 436 WLPQYS 441
gi 302875615 436 WLPQYS 441
gi 54301698  448 WLPQFA 453
gi 56962192  436 WLPQYK 441
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap