7BB3,7BB3,5XJL


Conserved Protein Domain Family
SMN_N

?
cd22851: SMN_N 
Click on image for an interactive view with Cn3D
N-terminal Gemin2-binding domain of the Survival Motor Neuron family
The survival motor neuron (SMN) protein family includes metazoan SMN and fungal SMN-like protein 1 (SMN1). SMN forms the oligomeric core of a multiprotein complex, called the SMN complex, that functions in the assembly and biogenesis of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. It is expressed in all tissues of metazoan organisms, but is particularly expressed at high levels in motor neurons. Schizosaccharomyces pombe SMN1 is essential for viability and has been shown to interact with human SMN and Sm proteins. Loss of function mutations in the SMN gene of humans cause spinal muscular atrophy (SMA), a leading genetic cause of infant mortality. While most eukaryotes have a single copy of the SMN gene, humans have two; the telomeric SMN1 gene is deleted or mutated in SMA patients, whereas the centromeric SMN2 gene is unaffected and can be present in multiple copies. SMN has three highly conserved domains: a short N-terminal region that is responsible for binding with high affinity to Gemin2; a central Tudor domain that recognizes symmetric dimethylarginine (sDMA) modifications in arginine/glycine rich regions of a number of proteins involved in RNA processing, including the Sm proteins; and a C-terminal domain called the YG-box that is primarily responsible for oligomerization. This model represents the N-terminal Gemin2-binding domain of SMN family proteins.
Statistics
?
PSSM-Id: 439367
Aligned: 65 rows
Threshold Bit Score: 38.6018
Created: 13-Oct-2021
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
 
Gemin2 binding
Conserved site includes 14 residues -Click on image for an interactive view with Cn3D
Feature 1:Gemin2 binding site [polypeptide binding site]
Evidence:
  • Structure:5XJL: Human SMN binds Gemin2 within the Gemin2:SMNGe2BD:Sm pentamer complex; contacts at 4A

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1              ###### ###### ##          
7BB3_A         5 SQKEVWDDSELRNAFETALHEFKKYHSIEAKG 36  Schizosaccharomyces pombe 972h-
5XJL_M         4 DDSDIWDDTALIKAYDKAVASFKHALKNGDIC 35  human
CCE27240       9 SHEEVWDDSALIDSWNEALAEYKLQSQTQEST 40  Claviceps purpurea 20.1
XP_023899426   7 SHAEVWDDSALVNSWNEALAEYKKYHSIAARG 38  Quercus suber
OAA66466       7 NTAAWDDTAAIANSWNQVVSDYKIFHTVRARG 38  Sporothrix insectorum RCEF 264
RDX51476     109 SHDEIWDDSALIDAWNSAAAEYEAYHGPGKSW 140 Polyporus brumalis
KIW67508      23 SQAEIWDDSALIRSWNDALAEYEYYHGIHARG 54  Phialophora americana
KIJ98246      86 THEEIWDDSALVDAWNAAMEEYEAYNGPDKGT 117 Laccaria amethystina LaAM-08-1
POS77783       9 ADDDVWDDSALIRSWDEALDEYKPSGQESDTL 40  Diaporthe helianthi
TID13779       8 ADPGIWDDGALINSWNEALEEYKKYHSIHVQK 39  Venturia nashicola

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap