Conserved Protein Domain Family
IPD_PPP1R12A-like

?
cd22527: IPD_PPP1R12A-like 
inhibitory phosphorylation domain of protein phosphatase 1 regulatory subunit 12A-like, and similar proteins
Protein phosphatase 1 regulatory subunit 12A-like (PPP1R12A-like) is a homolog of MYPT1, also called protein phosphatase 1 regulatory subunit 12A (PPP1R12A), myosin phosphatase target subunit 1, or protein phosphatase myosin-binding subunit. MYPT1 is the targeting subunit of smooth-muscle myosin phosphatase. It is a substrate for the asparaginyl hydroxylase factor inhibiting hypoxia-inducible factor (FIH). MYPT1 acts as a key regulator of protein phosphatase 1C (PPP1C). It mediates binding to myosin. As part of the PPP1C complex, MYPT1 is involved in dephosphorylation of the mitosis regulator polo-like kinase 1 (PLK1). It is capable of inhibiting HIF1A inhibitor (HIF1AN)-dependent suppression of HIF1A activity. This model corresponds to the inhibitory phosphorylation domain of PPP1R12A-like protein.
Statistics
?
PSSM-Id: 412022
Aligned: 6 rows
Threshold Bit Score: 70.6735
Created: 24-Aug-2020
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_005988050  678 ETKERRRSYLTPVRDEEAEAQRKARSRHARQSRRSTQGVTLTDLQEAEKT 727  coelacanth
XP_007909062  554 ELRERRRSYLIPVRDEESEAQRKARSRHARQSRRSTQGVTLTDLKEAEKI 603  elephant shark
TNN00229      611 ETKQRRKSYLTPVRDEEAEAQRKARSRHARQSRRSTQGVTLTDLQEAEKT 660  Takifugu bimaculatus
PIO39018      635 ETKERRRSYLTPVRDEEAEAQRKARSRHARQSRRSTQGVTLTDLKEAEKV 684  American bullfrog
XP_018115594  570 ETKERRRSYLTPVRDEEAEAQRKARSRHARQSRRSTQGVTLTDLKEAEKV 619  African clawed frog
XP_002666820  611 ETKQRRKSYLTPVRDEEAEAQRKARSRHARQSRRSTQGVTLTDLQEAEKT 660  zebrafish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap