Conserved Protein Domain Family
KH-I_PCBP4_rpt1

?
cd22517: KH-I_PCBP4_rpt1 
first type I K homology (KH) RNA-binding domain found in poly(rC)-binding protein 4 (PCBP4) and similar proteins
PCBP4, also called alpha-CP4, or heterogeneous nuclear ribonucleoprotein E4, or hnRNP E4, is a single-stranded nucleic acid binding protein that binds preferentially to oligo dC. It regulates both basal and stress-induced p21 expression through binding p21 3'-UTR and modulating p21 mRNA stability. It also plays a role in the cell cycle and is implicated in lung tumor suppression. PCBP4 contains three K-homology (KH) RNA-binding domains. The model corresponds to the first one.
Statistics
?
PSSM-Id: 411945
Aligned: 5 rows
Threshold Bit Score: 139.393
Created: 14-Aug-2020
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
 
putative DNAGXXG motif
Feature 1:putative DNA binding site [nucleic acid binding site]
Evidence:
  • Comment:Based on the structure evidence that Homo sapiens PCBP2 (2AXY) binds telomeric DNA.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                 #   ## #####  #   #       #### #   #                         
P57723        17 TLTLRMLMHGKEVGSIIGKKGETVKRIREQSSARITISEGSCPERITTITGSTAAVFHAVSMIAFKLDED 86  human
AAH65955       4 TLTLRLLMHGKEVGSIIGKKGETVKRIREESSARINISEGSCPERIITITGATECVFRAFTMITIKLEED 73  zebrafish
KFV20083      11 TLTLRMLMHGKEIGSIIGKKGETVKRIREQSSARITISEGSCPERITTITGSTDAVFRAVSMIAFKLEED 80  red-crested turaco
XP_030061702  52 TLTLRLLMHGKEVGSIIGKKGETVKRIREESSARVTISEGSSPERITTITGSTDAVFRAFSMIAFKLEED 121 Microcaecilia unicolor
XP_005987072  27 TLTLRLLMHGKEVGSIIGKKGETVKKIREESSARINISEGSCPERIVTITGSTDSVFKAFTMITVKLEED 96  coelacanth

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap