Conserved Protein Domain Family
KH-I_PCBP3_rpt1

?
cd22516: KH-I_PCBP3_rpt1 
first type I K homology (KH) RNA-binding domain found in poly(rC)-binding protein 3 (PCBP3) and similar proteins
PCBP3, also called alpha-CP3, or PCBP3-overlapping transcript, or PCBP3-overlapping transcript 1, or heterogeneous nuclear ribonucleoprotein E3, or hnRNP E3, is a single-stranded nucleic acid binding protein that binds preferentially to oligo dC. It can function as a repressor dependent on binding to single-strand and double-stranded poly(C) sequences. PCBP3 contains three K-homology (KH) RNA-binding domains. The model corresponds to the first one.
Statistics
?
PSSM-Id: 411944
Aligned: 6 rows
Threshold Bit Score: 150.639
Created: 14-Aug-2020
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
 
putative DNAGXXG motif
Feature 1:putative DNA binding site [nucleic acid binding site]
Evidence:
  • Comment:Based on the structure evidence that Homo sapiens PCBP2 (2AXY) binds telomeric DNA.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                        #   ## #####  #   #       #### #   #                         
P57721        38 SEGGLNVTLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEED 114 human
XP_007888857   6 TEGGLNVTLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAFKFEEE 82  elephant shark
XP_014344426   6 SEGGLNVTLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEED 82  coelacanth
XP_025008185   6 SEGGLNVTLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEED 82  chicken
NP_001018567   8 SEGGLNVTLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEED 84  zebrafish
NP_001086212   6 SEGGLNVTLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEED 82  African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap