6QEY


Conserved Protein Domain Family
KH-I_IGF2BP1_rpt2

?
cd22493: KH-I_IGF2BP1_rpt2 
second type I K homology (KH) RNA-binding domain found in insulin-like growth factor 2 mRNA-binding protein 1 (IGF2BP1) and similar proteins
IGF2BP1, also called IGF2 mRNA-binding protein 1 (IMP-1), or coding region determinant-binding protein (CRD-BP), or IGF-II mRNA-binding protein 1, or VICKZ family member 1 (VICKZ1), or zipcode-binding protein 1 (ZBP-1), is an RNA-binding factor that recruits target transcripts to cytoplasmic protein-RNA complexes (mRNPs). It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation. It regulates localized beta-actin/ACTB mRNA translation, a crucial process for cell polarity, cell migration and neurite outgrowth. IGF2BP1 can form homodimers and heterodimers with IGF2BP1 and IGF2BP3. It contains four K-homology (KH) RNA-binding domains which are important in RNA binding and are known to be involved in RNA synthesis and metabolism. The model corresponds to the second one.
Statistics
?
PSSM-Id: 411921
Aligned: 6 rows
Threshold Bit Score: 195.661
Created: 19-Jul-2020
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
 
putativeGXXG motif
Conserved site includes 17 residues -Click on image for an interactive view with Cn3D
Feature 1:putative nucleic acid binding site [nucleic acid binding site]
Evidence:
  • Comment:flanked by the GXXG motif and a variable ssRNA/DNA binding loop
  • Comment:Based on the structure evidence that other KH-I superfamily members bind RNA/ssDNA.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                     # ### #####  ##  ##    ####                                        
6QEY_A        83 TADEVPLKILAHNNFVGRLIGKEGRNLKKVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAEQEIMKKVREAYE 162 human
XP_007902598 197 TAEEVPLKILAHNNFVGRLIGKEGRNLKKVEQDTETKITISPLQDLTLYNPERTITVKGSIEACCKAEEDIMKKVREAYE 276 elephant shark
Q9NZI8       273 TADEVPLKILAHNNFVGRLIGKEGRNLKKVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAEQEIMKKVREAYE 352 human
Q08CK7       276 TADEVPLKVLAHNNFVGRLIGKEGRNLKKVEQDTDTKITISPLQDLTLYNPERTITVKGSIEACCLAEQEIMKKVREAYD 355 zebrafish
NP_990402    273 TADEVPLKILAHNNFVGRLIGKEGRNLKKVEQDTETKITISSLQDLTLYNPERTITVKGSIENCCKAEQEIMKKVREAYE 352 chicken
XP_014340525 270 TADEVPLKILAHNNFVGRLIGKEGRNLKKVEQDTDTKITISPLQDLTLYNPERTITVKGSIEACCRAEEEITKKVREAYE 349 coelacanth
Feature 1                         
6QEY_A       163 NDVAAMSLQSHLIPGLN 179 human
XP_007902598 277 NDIAAMNLQANLIPGLN 293 elephant shark
Q9NZI8       353 NDVAAMSLQSHLIPGLN 369 human
Q08CK7       356 NDIAAMNQQTHLIPGLN 372 zebrafish
NP_990402    353 NDVAAMSLQSHLIPGLN 369 chicken
XP_014340525 350 NDVAAMNLQSHLIPGLN 366 coelacanth

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap