6Q3V


Conserved Protein Domain Family
KH-I_N4BP1

?
cd22476: KH-I_N4BP1 
Click on image for an interactive view with Cn3D
type I K homology (KH) RNA-binding domain found in NEDD4-binding protein 1 (N4BP1) and similar proteins
N4BP1 interacts with and is a substrate of NEDD4 ubiquitin ligase (neural precursor cell expressed, developmentally downregulated 4, E3 ubiquitin protein ligase). It is also an inhibitor of the E3 ubiquitin-protein ligase ITCH, a NEDD4 structurally related E3. N4BP1 acts by interacting with the second WW domain of ITCH, leading to compete with ITCH's substrates and impairing ubiquitination of substrates.
Statistics
?
PSSM-Id: 411904
Aligned: 7 rows
Threshold Bit Score: 132.553
Created: 18-Jul-2020
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
 
putativeGXXG motif
Conserved site includes 17 residues -Click on image for an interactive view with Cn3D
Feature 1:putative nucleic acid binding site [nucleic acid binding site]
Evidence:
  • Comment:flanked by the GXXG motif and a variable ssRNA/DNA binding loop
  • Comment:Based on the structure evidence that other KH-I superfamily members bind RNA/ssDNA.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                    # ### #####  ##  ##    ####                              
6Q3V_A         70 PELEERECYPKDMHCIFVGAESLFLKSLIQDTCADLCILDIGLLGIRGSAEAVVMARSHIQQFVKLFE 137  human
O75113         75 PELEERECYPKDMHCIFVGAESLFLKSLIQDTCADLCILDIGLLGIRGSAEAVVMARSHIQQFVKLFE 142  human
Q5ZLE9         91 PELEEKEYYPKDMHCIFVGAQNMFLNSLIQDTCADITVLEIGLLSIKGGAEAVVMAQSQVQQFVKLFE 158  chicken
XP_005998415  110 PELEEKEYYPKDMHCIFVGAQNLFLNGLIQHTCADVSVLELGVLGIKGGTEAVVMARSRIQQFLKLFQ 177  coelacanth
Q7ZXG4         97 PEMEEKQSYPKEMHCIFAGAQGSFLNHLIRDTYANVTVPDIGVLSMKGGTEPVVMAQSRVQQFIRLFN 164  African clawed frog
XP_007887769  326 PEFRTVENYPKDMHCIFAGAKGLFRNFLVKYTCADISLEDIGVIAIAGNMEAVIMAKTRIQQFAKLFK 393  elephant shark
Q1LVK9        112 PELQKEEWYPVDMHCIFAGARGLFLDRLLRDTSAEVQVLEPGRLKLSGCAEAVVMAQSRVQQFVALFQ 179  zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap