Conserved Protein Domain Family
KH-I_KHDRBS2

?
cd22469: KH-I_KHDRBS2 
type I K homology (KH) RNA-binding domain found in KH domain-containing, RNA-binding, signal transduction-associated protein 2 (KHDRBS2) and similar proteins
KHDRBS2, also called Sam68-like mammalian protein 1, or SLM-1, is an RNA-binding protein that plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. It binds both poly(A) and poly(U) homopolymers. KHDRBS2 may function as an adapter protein for Src kinases during mitosis.
Statistics
?
PSSM-Id: 411897
Aligned: 4 rows
Threshold Bit Score: 221.15
Created: 20-Jul-2020
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
 
putative RNAGXXG motif
Feature 1:putative RNA binding site [nucleic acid binding site]
Evidence:
  • Comment:based on the structure evidence that Homo sapiens KHDRBS3 (5ELT) binds RNA.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                             # ### #####  ##         ###    ###                         
Q5VWX1        54 SNKNIKLSERVLIPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSGEAKYAHLSDELHV 133 human
Q0VFL3        54 SNKNIKLSERVLIPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKIKEEELRKSDEAKHAHLSDELHV 133 western clawed ...
XP_025004855  54 SNKNIKLSERVLIPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSGEAKYAHLSDELHV 133 chicken
Q08BJ2        54 SNKNIKLSERVLIPVQQYPKFNFVGKLLGPRGNSMKRLQEETGAKMSILGKGSMRDKGKEEELRKSGEAKYAHLSNDLHV 133 zebrafish
Feature 1                                              
Q5VWX1       134 LIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQ 171 human
Q0VFL3       134 LLEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQ 171 western clawed frog
XP_025004855 134 LIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQ 171 chicken
Q08BJ2       134 LIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQ 171 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap