5WWX,2DGR


Conserved Protein Domain Family
KH-I_MEX3_rpt2

?
cd22424: KH-I_MEX3_rpt2 
second type I K homology (KH) RNA-binding domain found in the family of MEX-3 RNA-binding proteins
The MEX-3 protein family includes four members, MEX3A/RKHD4, MEX3B/RKHD3/RNF195, MEX3C/ RKHD2/RNF194, and MEX3D/RKHD1/RNF193/TINO. They are homologous of Caenorhabditis elegans MEX-3 protein, a translational regulator that specifies the posterior blastomere identity in the early embryo and contributes to the maintenance of the germline totipotency. Mex-3 proteins are RNA-binding phosphoproteins involved in post-transcriptional regulatory mechanisms. They are characterized by containing two K-homology (KH) RNA-binding domains and a C-terminal RING finger. They bind RNA through their KH domains and shuttle between the nucleus and the cytoplasm via the CRM1-dependent export pathway. The model corresponds to the second KH domain.
Statistics
?
PSSM-Id: 411852
Aligned: 44 rows
Threshold Bit Score: 125.526
Created: 17-Jul-2020
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
 
RNA bindingGXXG motif
Conserved site includes 20 residues -Click on image for an interactive view with Cn3D
Feature 1:RNA binding site [nucleic acid binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                    # ### #####  ##  #     #######                            # 
5WWX_A        14 PGQTTVQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDKEPVFEVTGMPENVDRAREEIEMHIAMRT 85  human
EDV26812      83 PGHVTIKVRVPYRVVGLVVGPKGATIKRIQQQTNTYIVTPSRDKEPIFEVTGLQDNVERAREEIEGHIATRT 154 Trichoplax adhaerens
EFX83467     109 PGQVTIQVRVPYRVVGLVVGPKGATIKRIQQQTSTYIVTPSREKEPIFEVTGMPDNVEQAKREIEAHIALRT 180 common water flea
ELU03986      72 PGQVTIQVRVPYRVVGLVVGPKGATIKRIQQQAQTYIVTPSRDKEPIFEVTGLPDNVEKARREIENHIALRT 143 Capitella teleta
KFM77326     148 PGQTTIQVRVPYRVVGLVVGPKGATIKRIQQQTNTYIVTPSRDKEPIFEVTGLPDNVESARKEIEAHIAMRT 219 Stegodyphus mimosarum
KII68468      59 QFASYDYIEVPQSAVGLVVGNKGSMIKRFQDMTLTKIITPSKDMEPIFMIFGDREKVETAKVSIFKYVQNNL 130 Thelohanellus kitauei
XP_012561659 213 PGHVTKQVRVPYRVVGLVVGPKGSTIKRIQQATNTYIVTPSRDKEPVFEVTGLPDNVDRAKREVEHHIALRT 284 Hydra vulgaris
XP_013380853 203 PGQVTIQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDKEPIFEVTGLPENVEKAKKEIESHIAMRT 274 Lingula anatina
XP_019855841 182 PDKVAVYVKVPYRVVGLVVGPKGATIKRIQQITNTHIVTPSRDKEPCFEVSGKPEDVERAKKEIESYIAMRT 253 Amphimedon queenslandica
RUS80198     142 EGDVMIQVTVPYRVVGLVVGLKGQTIKAIQQDTDTFIVTPNRDKAPIFEIRGQPENVERAKSMILRHIETRT 213 eastern emerald elysia

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap