5WWW


Conserved Protein Domain Family
KH-I_MEX3_rpt1

?
cd22423: KH-I_MEX3_rpt1 
first type I K homology (KH) RNA-binding domain found in the family of MEX-3 RNA-binding proteins
The MEX-3 protein family includes four members, MEX3A/RKHD4, MEX3B/RKHD3/RNF195, MEX3C/ RKHD2/RNF194, and MEX3D/RKHD1/RNF193/TINO. They are homologous of Caenorhabditis elegans MEX-3 protein, a translational regulator that specifies the posterior blastomere identity in the early embryo and contributes to the maintenance of the germline totipotency. Mex-3 proteins are RNA-binding phosphoproteins involved in post-transcriptional regulatory mechanisms. They are characterized by containing two K-homology (KH) RNA-binding domains and a C-terminal RING finger. They bind RNA through their KH domains and shuttle between the nucleus and the cytoplasm via the CRM1-dependent export pathway. The model corresponds to the first KH domain.
Statistics
?
PSSM-Id: 411851
Aligned: 38 rows
Threshold Bit Score: 136.076
Created: 17-Jul-2020
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
 
RNA bindingGXXG motif
Conserved site includes 25 residues -Click on image for an interactive view with Cn3D
Feature 1:RNA binding site [nucleic acid binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                 ## ### ##### ###  #     #######                           ##  ##
5WWW_A        20 TTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPIFVVTGRKEDVAMAKREILSAAEHFSMIR 92  human
TLY46840      22 KTECVSVPSSNHVAEIVGKRGSKIKGLQAKTNTLIIPPKRYEEPVFVISGRKEDVAYAKRELLNASEYFTKIR 94  Gammaproteobacteria ba...
KFM65465      59 TTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVSAAKREILSAAEHFSQIR 131 Stegodyphus mimosarum
RDD37006      86 TTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEQPVFVVTGRREDVVAAKREIQSAAEHFSQIR 158 Trichoplax sp. H2
XP_009020346   5 TTDKVHVPSSEHVAEIVGRQGCKIKNLRFRTNTYIRTPPRDEEPVFVITGREADVREVRREIEEAAHHFTQLR 77  Helobdella robusta
NP_651934    123 MTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVNKAKREILSAADHFSLIR 195 fruit fly
OWF44498      65 MTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVNAAKREILSAAEHFSQIR 137 Yesso scallop
XP_019855841  75 VTHCVAVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVITGRPEDVSSAKREVLAAADHFTQIR 147 Amphimedon queenslandica
NP_490681     78 VTESVEVPTSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEDPIFVVTGRLEDVNEAKREIDCAAEHFTQIR 150 Caenorhabditis elegans
XP_013380853 102 VTESVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVEAAKREILSAGEHFSQIR 174 Lingula anatina

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap