Conserved Protein Domain Family
KH-I_Vigilin_rpt11

?
cd22414: KH-I_Vigilin_rpt11 
eleventh type I K homology (KH) RNA-binding domain found in vigilin and similar proteins
Vigilin, also called high density lipoprotein-binding protein, or HDL-binding protein, is a ubiquitous and highly conserved RNA-binding protein that shuttles between nucleus and cytoplasm presumably in contact with RNA molecules. It may be involved in chromosome partitioning at mitosis, facilitating translation and tRNA transport, and control of mRNA metabolism, including estrogen-mediated stabilization of vitellogenin mRNA. Vigilin is up-regulated by cholesterol loading of cells and functions to protect cells from over-accumulation of cholesterol. It may play a role in cell sterol metabolism. Disruption of human vigilin impairs chromosome condensation and segregation. Vigilin has a unique structure of 14-15 consecutively arranged, but non-identical K-homology (KH) domains which apparently mediate RNA-protein binding. The model corresponds to the eleventh one.
Statistics
?
PSSM-Id: 411842
Aligned: 20 rows
Threshold Bit Score: 107.004
Created: 17-Jul-2020
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
 
putativeGXXG motif
Feature 1:putative nucleic acid binding site [nucleic acid binding site]
Evidence:
  • Comment:flanked by the GXXG motif and a variable ssRNA/DNA binding loop
  • Comment:Based on the structure evidence that other KH-I superfamily members bind RNA/ssDNA.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                 # ### #####  ##  ##     ####                              
Q00341        802 EDSMLVDPKHHRHFVIRRGQVLREIAEEYGGVMVSFPRsGTQSDKVTLKGAKDCVEAAKKRIQEII 867  human
EDO37476      701 EGEVHVDPKWHRHFVAKRGEVLQEIAAEFGGVVVSFPRnGVNSDRVVLKGAKECVEGARQRVMEIV 766  starlet sea anemone
CAB52798      817 EGEVSVDPKHHKHFVAKRGFILHRISEECGGVMISFPRvGINSDKVTIKGAKDCIEAARQRIEEIV 882  fruit fly
EEC13290      813 EEEMHIDPRHHRHFVARRGEELRQIAEEFGGVQVSFPRsGEHSDLVQLKGARECVDGARKRILEIV 878  black-legged tick
XP_019852137  793 EDEVMVDSKYHRHFVQRRGQLIHEISDENGGVMITFPRaGTSSDKVTIKGAKQCVEGAKQAIAEVI 858  Amphimedon queenslandica
XP_013393956  797 EGEISVDPKYHRHFVARRGEVLHTIAADYGGVSVSFPRsGMKSDKVVLKGAKDCIEGAKKRIAEIV 862  Lingula anatina
XP_013097099  794 EGEVHVDPKHHRNFVARRGEVLRQIAEDYGGVIVSFPRsGVNSDRVVIKGAKECVEAAKKKILEIV 859  Biomphalaria glabrata
EFX88840      767 ELDMHVDPKYHRHFVARRGELLHEISDQYGGVTVSFPRsGVDSDRVVLKGAKECVEAAKQRIEEIV 832  common water flea
PAA78241      800 EESVEVDPRWHKAFMERRGFYITQISQDFGGVQLSFPR-EPGSSRVVVKGPKDCVQGAIARIREIV 864  Macrostomum lignano
XP_026691860  819 EIEMEIEQKHHKYFVARRGAVLRDIADEFGGVAVSFPRiGDESSTVRIKGPSECVEGAKSKLAELV 884  vase tunicate

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap