3BM3


Conserved Protein Domain Family
PspGI-like

?
cd22350: PspGI-like 
Click on image for an interactive view with Cn3D
Restriction endonuclease PspGI and similar nucleases
PspGI is an isoschizomer of EcoRII, it recognizes and cleaves the DNA sequence 5'-|CCWGG-3' (| denotes the cleavage site, W stands for A or T). It belongs to a superfamily of nucleases including very short patch repair (Vsr) endonucleases, archaeal Holliday junction resolvases, MutH methyl-directed DNA mismatch-repair endonucleases, and catalytic domains of many restriction endonucleases, such as EcoRI, BamHI, and FokI.
Statistics
?
PSSM-Id: 411754
Aligned: 3 rows
Threshold Bit Score: 425.978
Created: 10-Jan-2019
Updated: 30-Sep-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Structure:3BM3: Pyrococcus sp. restriction endonuclease PspGI active site binds substrate DNA; contacts at 4A
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                     
3BM3_A     20 TNEIIEEAITELNVDELLDRLFEKDESGEVITPSRIAKXLEEKAFEIYKEYEKQVREAYLSAGYSREKLEQSFQQARFSR 99  Pyrococcus sp. GI-H
AAC67524   20 TNEIIEEAITELNVDELLDRLFEKDESGEVITPSRIAKMLEEKAFEIYKEYEKQVREAYLSAGYSREKLEQSFQQARFSR 99  Pyrococcus sp. GI-H
CUX78503   20 TNEIVEEAITELNVDELLDKLFEKDERGEVITPSRIAKMLEEKAFEIYKEYEKQVREAYLSARYSREKLEQSFQQARFSR 99  Thermococcus chito...
Feature 1          #                                #                   # #                   
3BM3_A    100 GGKAFEIIFTKLLNKFGIRYEHDRVIKIYDYITEGEKPAFIIPSVRTFLNDPSSAILITVKRKVRERWREAVGEAQILRN 179 Pyrococcus sp. GI-H
AAC67524  100 GGKAFEIIFTKLLNKFGIRYEHDRVIKIYDYITEGEKPDFIIPSVRAFLNDPSSAILITVKRKVRERWREAVGEAQILRN 179 Pyrococcus sp. GI-H
CUX78503  100 GGKTFEVIFTKLLDRFGIRYEHDRMIKIYGYITEGEKPDFIIPSVRTFLNDPSSAILITVKRKVRERWREAVGEAQILRN 179 Thermococcus chito...
Feature 1                                                                                    
3BM3_A    180 KFGDEINFWFVGFDEEFTIYSAIAXLDNGIDRVYVIDGRYDSLIEEIKRISDPNFNEDKYIQKIRRFSDIFDDIIQFLN 258 Pyrococcus sp. GI-H
AAC67524  180 KFGDEINFWFVGFDEEFTIYSAIAMLDNGIDRVYVIDGRYDSLIEEIKRISDPNFNEDKYIQKIRRFSDIFDDIIQFLN 258 Pyrococcus sp. GI-H
CUX78503  180 KFGDKINFWFVGFDEEFTVYSAIAMLDNGIDRVYVIDGRYDSLIEELKRISDPNFNEDKYIQKIRRFSDIFDDIIQFMN 258 Thermococcus chiton...

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap