Conserved Protein Domain Family
cc_LAMB2_C

?
cd22299: cc_LAMB2_C 
C-terminal coiled-coil domain found in laminin subunit beta-2 (LAMB2)
LAMB2 is also called laminin B1s chain, laminin-11 subunit beta, laminin-14 subunit beta, laminin-15 subunit beta, laminin-3 subunit beta, laminin-4 subunit beta, laminin-7 subunit beta, laminin-9 subunit beta, S-laminin subunit beta, or S-LAM beta (LAMS). It is an important component of the interphotoreceptor matrix and plays a role in rod morphogenesis. It may also have an important function in the sarcolemmal basement membrane. Mutations of the LAMB2 gene mainly cause Pierson syndrome (microcoria-congenital nephrosis syndrome). LAMB2 is a component of laminin, a complex glycoprotein consisting of three different polypeptide chains (alpha, beta, gamma). Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration, and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. This model corresponds to the C-terminal coiled-coil domain of LAMB2, which may be involved in the integrin binding activity.
Statistics
?
PSSM-Id: 411970
Aligned: 7 rows
Threshold Bit Score: 109.84
Created: 4-Aug-2020
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
 
putative trimer
Feature 1:putative trimer interface [polypeptide binding site]
Evidence:
  • Comment:based on the structure evidence that Homo sapiens LAMB1 forms a trimer with LAMC1 and LAMA5
  • Comment:laminin is a complex glycoprotein consisting of three different polypeptide chains (alpha, beta, gamma)

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1            ##  ## ##  #      ## ##  #  ##  ## ### ##  #  ## ### ## ### ### #### 
P55268       1727 AQARAEQLRDEARDLLQAAQDKLQRLQELEGTYEENERALESKAAQLDGLEARMRSVLQAINLQVQIYNTCQ 1798 human
NP_001088164 1712 AKTKADQLQDEAKKLLDNAQDKLKRLQDLEVEYTKNEKLLQDKAKQLNGLEDKMKEILHGINQQIQIYNTCQ 1783 African clawed frog
NP_001229974 1711 AKHKAEQLRDEAKGLLKDAQDKLQRLAELEKDYEENQKVLEGKARQLDGLEDKMKAILNAINRQIQIYNTCQ 1782 zebrafish
XP_007888581 1707 AKRKAEQLRDEARQLLRDAQNKLERLNVLERQYVVNEHVLEGKAQQLDKLEEKMKSILKAINLQIQIYNTCQ 1778 elephant shark
XP_014345029 1695 AKGKAEVLRDEAKRLLKEAQEKLQRLTDLEVKYEGNEKVLEDKARQLGGLEDKMRGILNAINQQIQIYNTCQ 1766 coelacanth
NP_989497    1721 AGGRAQQLREEAAGLLQDAQGKLQKLRALEEAYERNERVLDAKVAQLDGLEARMREVLATINQQVQIYNTCQ 1792 chicken
PXF62332      214 AKHKAESLRDEAKELLRDAQDKLERLNDLEVQYEANEQVLEGKARQLDGLEEKMKEILKAINQQIQIYNTCQ 285  Kangiella spongicola

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap