5FCN,5FCN


Conserved Protein Domain Family
cc_Cep135_MBD

?
cd22292: cc_Cep135_MBD 
coiled-coil microtubule binding domain of centrosomal protein of 135 kDa (Cep135) and similar proteins
Cep135, also called centrosomal protein 4, is involved in early centriole assembly, duplication, biogenesis, and formation. It is required for the recruitment of CEP295 to the proximal end of new-born centrioles at the centriolar microtubule wall during early S phase in a PLK4-dependent manner. This model corresponds to a conserved coiled-coil domain of Cep135, which is critical for microtubule binding.
Links
?
Statistics
?
PSSM-Id: 412088
Aligned: 57 rows
Threshold Bit Score: 60.2733
Created: 30-Sep-2020
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
 
homodimer
Conserved site includes 29 residues -Click on image for an interactive view with Cn3D
Feature 1:homodimer interface [polypeptide binding site]
Evidence:
  • Structure:5FCN: Homo sapiens Cep135 forms a homodimer through its coiled-coil domain; contacts at 4A
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1          #  ##  ## ##  ## ##  ## ##  ## ##  ## ##  ## ##  ##          
5FCN_B          2 SNNELYLELMKLREHSDQHVKELKTSLKKCARETADLKFLNNQYAHKLKLLEKESKAKNERI 63   human
XP_021916482   82 ECNDLHMKLLHQTEDSDKKQKDLKLRVRKLESDNSDLQFLSSQHIARIKALEQESAQKTRKI 143  Zootermopsis nevadensis
TGZ38375      110 ECNQLHSDLIETKEAHQKQVKDLKRQIYKLECECNDLQLASSRNIHKIKELEAESAAKSKKI 171  Temnothorax longispinosus
ODM96005       49 ENSKLRMGITRAIEEADDKTRDPLSRLRDLEEENNDLKLLVSQFAERVKKSDVETLEKTKRI 110  Orchesella cincta
KXS21394      133 ENNRLHVELIKSADTRDLREKETLKLVRKLETELADARFMNTQYLQKISVEQQRADRERTKV 194  Gonapodya prolifera JEL478
ORZ31166       35 ENNNLHKRLIASADAHDQHARKTTMVIRKLEQELQDLRFLNSQYASTIQQEQRRLDEERRRV 96   Catenaria anguillulae PL171
TPX64074       96 ENNHLHHDIVRLADERDAREKRTAQAARRFESQTADLRFVASQYAHRVEVEQQRVEEARAKT 157  Spizellomyces sp. 'palustris'
CDW91010      899 ENNDLHMQMIKVKEECEQRENTMKSQLRQIQNEKTDLQFLANQKDFKIQELDKTIIAMRNKL 960  Stylonychia lemnae
OAJ37363      127 ENNHLHLDLIRMADERDARAKRAADNIRKADSQTADLRFMSCQYQARVVEEQRKVEDARTKV 188  Batrachochytrium dendrobatidis ...
RKP04096      177 DNNQLHRDVVTLAEEKEAAERRSQQAARAVESQMADLRFQNAQYAQQVQQERERAEQWRNKI 238  Caulochytrium protostelioides

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap