5UZ9,6B47,5YHR


Conserved Protein Domain Family
AcrIF2

?
cd22280: AcrIF2 
Anti-CRISPR type I subtype F2
AcrIF2 (also known as AcrF2) is an anti-CRISPR (Acr) protein which functions as a double-stranded "DNA mimic protein" (DMP) that binds to the type I-F CRISPR-Cas surveillance complex (Csy) and excludes target DNA binding. The key feature of DMPs is their DNA-like shape and charge distribution, and they affect the activity of DNA-binding proteins by occupying their DNA-binding domains. Acidic residues on the surface of AcrIF2 mimic the negative charge distribution on the helical backbone of a DNA duplex. The type I-F Csy complex is a crRNA-guided surveillance complex, composed of a crRNA and nine Cas proteins (one Cas8f, one Cas5f, one Cas6f, and six Cas7f), which recruits a nuclease-helicase protein Cas3 for target degradation. CRISPR-Cas immune systems are used by certain prokaryotes and archaea to resist the invasion of foreign nucleic acids such as phages or plasmids. Anti-CRISPRs are small proteins which are the natural inhibitors for CRISPR-Cas systems; encoded on bacterial and archaeal viruses, they allow the virus to evade host CRISPR-Cas systems. The CRISPR-Cas-mediated adaptive immune response can be divided into three steps, including the acquisition of spacer derived from invading nucleic acids, crRNA processing, and target degradation. Theoretically, Acr proteins could suppress any step to disrupt the CRISPR-Cas system. Acr proteins are diverse with no common sequence or structural motif which inhibit a wide range of CRISPR-Cas systems with various inhibition mechanisms. CRISPR-Cas systems are divided into two classes (1 and 2) and six types (class 1: types I, III and IV; class 2: types II, V and VI). Class 1 systems utilize RNA-guided complexes consisting of multiple Cas proteins as the effector proteins to recognize and cleave target DNA. Type I CRISPR-Cas systems are the most widespread in nature, and the Cas protein composition of the employed CRISPR ribonucleoprotein (crRNP) complexes differs between seven subtypes (A to F, U). Acr families are named for their type and subtype which are numbered sequentially as they are discovered.
Links
?
Statistics
?
PSSM-Id: 412082
Aligned: 6 rows
Threshold Bit Score: 115.141
Created: 30-Sep-2020
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
 
oligomer
Conserved site includes 13 residues -Click on image for an interactive view with Cn3D
Feature 1:oligomer interface [polypeptide binding site]
Evidence:
  • Comment:AcrIF2 binds to the type I-F CRISPR-Cas (Csy) complex and with the Csy1:Csy2 heterodimer through interactions with Csy1. AcrIF2 prevents the DNA-binding activity of the Csy complex.
  • Structure:6B47; Pseudomonas phage anti-CRISPR AcrIF2 interacts mainly with Csy1 within the type I-F CRISPR RNA (crRNA)-guided surveillance complex (Csy complex); contacts at 4A.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                            #####   ###           ####                                 
5UZ9_K        8 IAQQHKDTVAACEAAEAIAIAKDQVWDGEGYTKYTFDDNSVLIQSGTTQYAMDADDADSIKGYADWLDDEARSAEaSEIE 87  Pseudomonas viru...
6B47_K        4 IAQQHKDTVAACEAAEAIAIAKDQVWDGEGYTKYTFDDNSVLIQSGTTQYAMDADDADSIKGYADWLDDEARSAEaSEIE 83  Pseudomonas viru...
5YHR_A        9 IAQQHKDTVAACEAAEAIAIAKDQVWDGEGYTKYTFDDNSVLIQSGTTQYAXDADDADSIKGYADWLDDEARSAEaSEIE 88  Pseudomonas viru...
EZN85338      8 IAQQHKDTVAACEAAEAIAIAKDQVWDGEGYTKYTFDDNSVLIQSGTTQYAMDADDADSIKGYADWLDDEARTAEdSEIK 87  Pseudomonas aeru...
WP_130533826  2 IAQQHTDSQLAAGVAESWAVSKDQIWGGEGYTLYVFNDNSILAQSGPEQIAVDADDPESVQAYVQWLGDDAPLDQ-QRLD 80  Pseudoxanthomona...
Q6TM72        2 IAQQHKDTVAACEAAEAIAIAKDQVWDGEGYTKYTFDDNSVLIQSGTTQYAMDADDADSIKGYADWLDDEARSAEaSEIE 81  Pseudomonas viru...
Feature 1          #  
5UZ9_K       88 RLLESV 93  Pseudomonas virus D3112
6B47_K       84 RLLESV 89  Pseudomonas virus D3112
5YHR_A       89 RLLESV 94  Pseudomonas virus D3112
EZN85338     88 RLLEAV 93  Pseudomonas aeruginosa 3579
WP_130533826 81 EIIAAL 86  Pseudoxanthomonas sp. NML130969
Q6TM72       82 RLLESV 87  Pseudomonas virus D3112

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap