Conserved Protein Domain Family
HkD_Girdin

?
cd22229: HkD_Girdin 
Hook domain found in Girdin and similar proteins
Girdin, also called Akt phosphorylation enhancer (APE), or coiled-coil domain-containing protein 88A (CCDC88A), or G alpha-interacting vesicle-associated protein (GIV), or Girders of actin filament, or Hook-related protein 1 (HkRP1), is a bifunctional modulator of guanine nucleotide-binding proteins (G proteins). It acts as a non-receptor guanine nucleotide exchange factor which binds to and activates guanine nucleotide-binding protein G(i) alpha subunits. It also acts as a guanine nucleotide dissociation inhibitor for guanine nucleotide-binding protein G(s) subunit alpha GNAS. In addition, Girdin plays an essential role in cell migration.
Statistics
?
PSSM-Id: 411800
Aligned: 6 rows
Threshold Bit Score: 267.041
Created: 21-Jul-2020
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
 
putative
Feature 1:putative LIC-binding interface [polypeptide binding site]
Evidence:
  • Comment:the conserved Hook domain interacts directly with the dynein light intermediate chain 1 (LIC1)
  • Comment:based on the structure evidence that Homo sapiens Hook 3 (6B9H) interacts with a dynein light intermediate.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                         
Q3V6T2         10 LEQFMTSPLVTWVKTFGPLaagnGTNLDEYVALVDGVFLNQVMLQINPKlESQRVNKKVNNDasLRMHNLSILVRQIKFY 89   human
XP_006001593   11 LEQFMSSPLVTWVKTLGPSargnGRKLDEYVDLVDGIFLNEVMLQINPKsANQRINKKINNDafLRIQNLSILVRQIKLY 90   coelacanth
CAG32145        9 LEEVTRSPLVTWVRTFGPLadenGTSLEEYMTLVDGVFLNEVMLQINPKsTNRNVNKRVNNDesLRIQNLCILVKKIKYF 88   chicken
XP_007890586    9 LEQFMSSPLVTWVKTYGPLspanGGVLSEYVELVDGFFLSNLMVQINAKsVNQRLNKKVNNDaaLRIQNLSTLVQHIKLY 88   elephant shark
XP_018117993   10 LENFMSSPLVIWIKTFGPLlkgtGPQLDEYLALIDGVFLNEVLMLINPKaDSQRIYRKINNDasLRIQNLSVLVKQMKSY 89   African clawe...
XP_017209909    8 LEEFIRSPLVCWVKTVERLlt-dGSPLAEFMALADGVFLNDIMIRINPNtSVQRAHKKVNNDptLRIQNLSILTLHIKTY 86   zebrafish
Feature 1                                                    #     #  ## #    #  ## ##  ##  # 
Q3V6T2         90 YQETLQQLIMMSLPNVLIIGKNPFSEQGTEEVKKLLLLLLGCAVQCQKKEEFIERIQGLDFDTKAAVAAHIQEVTH 165  human
XP_006001593   91 YQETLQQLIMMSLPNVLVLGRNPLSEQGIEEMKKMLLLLLGCAVQCEKKEEFIERIQSLDFDTKAAIAAHIQEVTH 166  coelacanth
CAG32145       89 YQECLQQLIVMALPNVLIIGRNPLSEPGTNEINKILLLLLGCAVQCQKKEEFIERIQHLDFDTRAAVAAHIQEVTQ 164  chicken
XP_007890586   89 YQENLQQLIMMSLPNVLVLGRSPLTEHGIEEMKKLLLLLLGCAVQCERKEEFIEKIQNLDFDTKAAVAIHIQEVTH 164  elephant shark
XP_018117993   90 YQESLQQLVMMSLPNVLTIGKNPFSEQGTEEMKKLLLLLLGCAVQCERKEEFIEKIQDLDFDTKAAVAAHIQEVTH 165  African clawed frog
XP_017209909   87 YQEVLQQLVVMSLPDVLVLGRTPLSEQALEEMRKLLLLLLGCAVQCDRKEEYIDRIQTLDLDTQAAIAAHIQEVTH 162  zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap