Conserved Protein Domain Family
WH2_DdVASP-like

?
cd22062: WH2_DdVASP-like 
Wiskott Aldrich syndrome homology region 2 (WH2 motif) found in Dictyostelium discoideum Vasodilator-stimulated phosphoprotein (VASP) and similar proteins
This family contains the Wiskott-Aldrich syndrome protein (WASP)-homology domain 2 (WH2) found in Dictyostelium discoideum vasodilator-stimulated phosphoprotein (VASP) and similar proteins. VASP belongs to the Ena/VASP protein family whose members act as actin polymerases that drive the processive elongation of filament barbed ends in membrane protrusions or at the surface of bacterial pathogens. These actin-associated proteins are involved in a range of processes dependent on cytoskeleton remodeling and cell polarity such as lamellipodial and filopodial dynamics in migrating cells. VASP plays a crucial role in filopodia formation, cell-substratum adhesion, and proper chemotaxis. It nucleates and bundles actin filaments via oligomers that use their WH2 domains to effect both the tethering of actin filaments and their processive elongation in sites of active actin assembly.
Statistics
?
PSSM-Id: 409205
Aligned: 15 rows
Threshold Bit Score: 49.6949
Created: 25-Jun-2020
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
 
actin-bindingactin-binding
Feature 1:actin-binding motif [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1           ## ### ###      ####        
Q5TJ65       196 GGTGRNALLGSIENFsKGGLKKTVTVDKSAG 226  Dictyostelium discoideum
XP_002167826 739 APAGRGALLSSISTFgKGNLKKCKTNDRSAP 769  Hydra vulgaris
NP_001090231 544 NGTERGALLSSIQNFrKGGLKKTTTNDHSTP 574  African clawed frog
XP_004348895 469 PQPARGALLSSITGFnKSGLSKTKTNDRSAP 499  Capsaspora owczarzaki ATCC 30864
XP_002124930 535 AGAGRGALLGSIQGFsKASLKKSVTVDKSGP 565  vase tunicate
XP_004344283 876 SQPGRGDLLSSISNF-KGGLRKVQTNDRSSP 905  Capsaspora owczarzaki ATCC 30864
NP_001076277 543 NGVGRGALLSSIQSFsKNKLKKAETVDRSGP 573  zebrafish
XP_030827987 533 QPPERGALLSSISGFnKGGLKKTQTADKSGP 563  purple sea urchin
XP_004353037 271 DTKGRGALLGSIEGFsKGKLKKATTNDRSTP 301  Acanthamoeba castellanii str. Neff
XP_003384005 564 KTGERGALLNSIESFaKGKLKKTVTKDRSGP 594  Amphimedon queenslandica

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap